KEGG   Hippocampus comes (tiger tail seahorse): 109528786Help
Entry
109528786         CDS       T04969                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00562  Inositol phosphate metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109528786
   00562 Inositol phosphate metabolism
    109528786
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109528786
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109528786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109528786
NCBI-ProteinID: XP_019747309
UniProt: A0A3Q2XW02
Position
Unknown
AA seq 466 aa AA seqDB search
MQINIRMILLVYLVGTLRCFSSFLNKASIPRIAKYFGTKGRYEDVNPHLLEDILAVNTSI
LQPPFPQCRPIHLTAIIRHGTRYPTRAIFKHMQDMYKVVKSATPDKENWVCEIQTQWKMW
YPDDMDGRLARKGVDDHKHLAVRLSKLFPTLLSEENLRGGLVKFISSSKHRCLNSTLSFM
AGLTEQWGIQDQTFDYEVNDALMKYFVHCTKFVEDVIRNPSALSQVDKFKEGPEMRSVRE
KIANQLRVPYKNITADMADAAMNLCAYELAIKTVNSPWCQSLDEVDAKIVEYANDLRQFW
KRGYGHDINRKSSCILFHDVFSRLDKAANENTSGQQVTEAVTIQVGHGETLLPLYTLMGF
FKDDEPLTSSNYASQHQRSFRPSLVLPYAANLLLALYDCGEGNLRLQPLINEKPVSFPGL
TESQQAPMPLYEDVKEHYKELIQGCDFETECELFSRPDQVLIKEAL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaacattcggatgatcctccttgtttacttggtaggcacgcttcgttgcttc
agcagttttctcaacaaagccagtataccaaggattgccaaatactttggtaccaaaggt
cggtatgaagacgtaaaccctcatcttttagaggacatcctggccgtcaacacatccatt
ctccagcctccatttccacaatgccgtcccattcatctgaccgctattataagacacggc
acgagatacccgacgagagcgatcttcaagcacatgcaagacatgtacaaagtggtaaaa
agtgccacgcctgacaaagagaactgggtatgcgagatccagacccagtggaagatgtgg
tatcctgatgacatggacggtcggttagcccggaaaggcgtggatgatcacaaacatctg
gcggtcaggctatccaagctgttccccacgctgctttctgaggagaatcttcgaggagga
cttgtgaagtttataagcagctccaagcacaggtgcctcaacagcactctgtcctttatg
gcgggactgacagagcagtggggtattcaagatcagacatttgactacgaggtgaacgac
gcactcatgaagtattttgtccactgcaccaagtttgtggaggatgttatcaggaacccc
tcagccctgtcgcaggttgacaaattcaaagagggaccggagatgaggtcggtccgggag
aagattgccaaccaactccgagtcccctacaagaatatcacagctgacatggctgacgct
gcaatgaacttgtgcgcctacgagttggccatcaagaccgtcaactctccctggtgtcag
agcttggatgaggttgacgctaagatagtggagtatgcgaatgacctgaggcaattctgg
aagagaggctacggtcatgatattaacagaaagtccagctgtattcttttccatgatgtc
ttcagtcgtctggacaaagcggccaatgaaaatacgtccggccagcaggtgaccgaagca
gtgacgatccaagtaggccatggagagaccctccttccactctacaccctcatgggcttc
ttcaaggacgacgaacccctgacgtcgtcaaactacgcatcgcaacaccaacgctctttc
cgccccagcctcgtgctaccgtatgcggcgaacctgctactcgcgctgtatgactgcgga
gaaggaaacttgaggttgcagccactgattaatgagaaaccagtgagcttccctggtttg
actgagagtcagcaggcacccatgccactgtatgaagacgtcaaagaacactacaaggaa
ctgatccaaggctgtgactttgagacggagtgtgaattgttcagtagacctgatcaagtt
ttaattaaagaggccttgtag

DBGET integrated database retrieval system