KEGG   Hippocampus comes (tiger tail seahorse): 109530275Help
Entry
109530275         CDS       T04969                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04060  Cytokine-cytokine receptor interaction
hcq04068  FoxO signaling pathway
hcq04144  Endocytosis
hcq04218  Cellular senescence
hcq04350  TGF-beta signaling pathway
hcq04371  Apelin signaling pathway
hcq04520  Adherens junction
hcq04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109530275
   04350 TGF-beta signaling pathway
    109530275
   04371 Apelin signaling pathway
    109530275
   04068 FoxO signaling pathway
    109530275
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109530275
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109530275
  09143 Cell growth and death
   04218 Cellular senescence
    109530275
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109530275
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109530275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109530275
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109530275
Protein kinases [BR:hcq01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   109530275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase DX FTA2
Motif
Other DBs
NCBI-GeneID: 109530275
NCBI-ProteinID: XP_019749430
Position
Unknown
AA seq 681 aa AA seqDB search
MDTIPCILIVLFSLTRIQENNALQCHCERCSANSSCTTDGVCFVNIRKTGNTLTTELRQC
VPEKELFPRDRPFICAPSFKHDTGLYPICCTTDYCNKDPDLTVFPVPTAKTPSLGPVALA
AVIAGPVCIFCLLLVLAFYVYSESHQTFRRSVVWYKCNFTDVSSHSVREFPFPNVGKTHF
YLICNSFRPDFFPPALQCHCERCSANSSCTTDGVCFVNIRKTGNTLTTELRQCVPEKELF
PRDRPFICAPSFKHDTGLYPICCTTDYCNKDPDLTVFPVPTAKTPSLGPVALAAVIAGPV
CIFCLLLVLAFYVCHSHRGLGAGGAGPHHHHHHHRVPNEEDPSMDHPFITVGTTLKDLIY
DMTTSGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSW
FREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGM
IKLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSAT
DTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSMGGIHE
DYQLPYYDLVQSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAAR
LTALRIKKTLSQLSQQEGIKM
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggatacaataccatgcattttgatcgtcttgttttccttaacgaggatacaggaaaat
aacgccctccagtgtcactgcgagcgctgcagtgccaactcgagctgcacaacagatggc
gtctgtttcgtcaacatccgcaagacgggcaacaccttgacaacggagctgcgccagtgc
gttcccgaaaaagagctgttcccgcgggatcgacccttcatctgcgccccatccttcaag
catgacactggcctttatcccatttgctgtaccaccgattattgcaacaaggaccctgac
ctcaccgttttccctgtccctactgcaaagactccatctctgggacccgtggctcttgcc
gcggtgattgccgggccggtgtgtatcttctgcttgctgctggttttggcgttctacgtc
tactccgagtcacatcaaacattccgaaggagcgtggtgtggtataagtgcaattttact
gacgtgtcgtctcattccgtcagggagtttccattccctaatgttggcaaaacacacttt
tacctcatttgtaactcctttcgccctgattttttccctccagccctccagtgtcactgc
gagcgctgcagtgccaactcgagctgcacaacagatggcgtctgtttcgtcaacatccgc
aagacgggcaacaccttgacgacggagctgcgccagtgcgttcccgaaaaagagctgttc
ccgcgggatcgacccttcatctgcgccccatccttcaagcatgacacgggcctttatccc
atttgctgtaccaccgattattgcaacaaggaccctgacctcaccgttttccctgtccct
actgcaaagactccatctctgggacccgtggctcttgccgcggtgattgccgggccggtg
tgtatcttctgcttgctgctggttttggcgttctacgtctgccacagccaccgggggctg
ggggccggcggggcagggccccaccatcaccaccaccaccaccgcgtgccgaacgaggag
gatccctccatggaccaccctttcatcaccgttggaacaaccctgaaggacctcatctat
gatatgaccacctcaggttcaggatcgggcctgcctcttcttgtccagagaaccatcgcc
aggaccatcatcctccaggaaagcatagggaaggggcgttttggggaggtgtggcgaggt
aaatggcgtggcgaggaagtggctgtgaagattttctcctcccgggaggagcggtcttgg
ttccgagaggctgagatctaccaaaccgtgatgctgcgacatgagaacattttgggcttc
atcgccgcagacaacaaagataatgggacctggactcaactgtggctggtgtcggactat
cacgagcacggctctctgttcgactacctgaaccgctacactgtcaccgtcgaaggcatg
atcaagctgtctctgtccaccgcgagtggcctggcccacctccacatggaaattgttggc
acacaaggcaagccagcgatcgctcaccgagacctgaagtcaaagaacattctggtgaag
aagaacggaacctgctgcattgcagatttaggtctcgctgtccggcatgactcggccacc
gacaccattgacatcgctccgaatcacagggtgggaaccaaaaggtatatggcgccagaa
gtactggatgactccataaacatgaaacactttgaatccttcaagcgagccgacatctac
gccatgggattggtattctgggagattgccagtcgctgctccatgggaggaatccatgag
gactaccagctaccatactatgacctggttcagtcagatccatcagtggaggagatgagg
aaggtggtttgcgagcagaagcttcgtccgaacattcccaaccgctggcagagctgcgag
gcgttacgtgtcatggctaagatcatgagagagtgctggtacgccaacggcgccgcccga
ctcacggcgctgcggatcaagaagaccctctcccagctcagtcaacaggagggaatcaag
atgtag

DBGET integrated database retrieval system