KEGG   Hippocampus comes (tiger tail seahorse): 109530543Help
Entry
109530543         CDS       T04969                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109530543 (dock7)
Membrane trafficking [BR:hcq04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109530543 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2 DUF3398 DHR-2 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109530543
NCBI-ProteinID: XP_019749926
Position
Unknown
AA seq 1704 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLFKNLNAGTLTSNTVPLTEAVEPVDFEE
YLITHPPIVESGPLRDLIEFPPDDIEVIYTPRECRTVVQAIPEEGDTDPHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNSLDKQKERQKGLPKQVFEADELPDSSGYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDSLLPHLLDRAPNEEIDRHNEDQRKTNRHRELFALHPAL
DEEDPIERHCVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFFF
DLNSEQTKAMLRPHIQTAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPY
MVFKESDANKNKEKLEKLRSQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MSLSERKGSWSERRNSSIMGRRSLERTTSGDESCSLTGFRPATLTITNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLLQVKPYPDSRVRPTR
DILEFPARDVYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPNNAMQVIF
GKSSCADFYKEAYTSVVYHNRSPDFHDEIKIKLPASLSDHHHILFTFYHVSCQQKQNTLL
ETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
VVAVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENNLETELKSSIAALNSSQLE
PVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQSSFEVMAAIVNRLHKYLDTSQDMHGRNS
LLSSYIHYVFRLPSTDPNSPSPDVKSTSTGPGGLGGSVHYATMARSAVRPASLNLNRSRS
LSNSNPDISGTPTSPDDEVRAIIGSKGLDRSNSWVHTMGCKSAPWGSSPGSAPETMQAME
RCGNRMSSHTESASFLQTLTGRLPTKKLFHEELALQWVVSSGSVREGALQQAWFFFELMV
KSIIHHLYFAERLESPRKNRFPERFMDDITALVSTIAGDIVSRFQKDLELVERLNTSLAF
FLNDLLSVMDRGFVFTLIKAYWKQVSTKVYALQNPTLESLRLDFLRIVCSHEHYVTLNLP
CSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQHFMAGLVLSELSVI
LDPDNEGMFGLHKKVVSVVHNLLSSHDSDPRYADSEVKARVAMLYLPLIGIVMETLPQLH
DFTESLNQWGRSGGVQGTTVCSNGDDAEAEGNNMINQTVAMAIAGTTTTSPMSRPSSFLL
NSQANRQHGSFSAESSRSLLICLLWVLKNADELVLQKWFTDLSVSQLNRLLDLLYLCVSC
FEYKAHVVFTMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERS
PSGSAFGSQENLRWRKDMTHWRQNSERLDKSHRSHRTRAELEHEALIDGNLATEANLIIL
DTLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFE
EETEQCADLCLRLLRSCSSSISTIRAHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSL
VGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQE
DPEMLIDLMYRYCTKLMNVQENQF
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgccgcgccttcgcccagaagataagcaggactgtggcagcagaggtcagg
aagcaaatagcgggtcagtatgggggctcaccgcaactcttcaagaacctcaatgctggg
accttaacaagtaacacagttccacttacagaggcagtcgagccagtggatttcgaagag
tacctcatcactcaccctccaattgtggagtcaggaccccttagagatttgatagagttt
cccccagatgacatagaggtcatctacacacccagggaatgtcgaacagtagtacaagcc
atcccagaggaaggggacactgaccctcatgtgagagactgtgtcagatcttacacagag
gactgggcaatagtcaacagaaaataccacaaacttggcacaggttttaaccctaattcg
ttggataagcagaaggagcgccagaaggggttgcccaaacaagtgtttgaggctgatgaa
ttaccggacagcagtggctaccaggatgaccaggatgaccttaaacgacggtcgatgtcc
attgatgacacccctcggggtagctgggcttgcagcatctttgacttgaagaattccctc
ccggactctctcctcccacatctccttgatcgtgcccccaatgaagagattgacagacac
aatgaagatcaacgcaagaccaaccgccatcgggaactctttgctctgcatccagccctt
gatgaggaggaccccatcgagcggcactgtgtgcctgatgttccaaaagaacactttggc
cagaggttacttgtcaagtgcttgtccctgaaatttgaaatcgaaattgagcccatattc
gctagtttggctttatatgatgtcaaggaaaagaaaaagatatcagagaattttttcttt
gacctgaattccgagcagacgaaggcaatgttgcgtccacacattcaaactgcagccatt
tccactttagcacgctcagccatattctcaatcacctacccctctcaggatgtctttctg
gtcatcaagttggagaaggtgctacagcaaggagatattggggagtgtgcggaaccttat
atggtgtttaaagaatctgacgcaaacaagaataaagaaaaattggagaaactccgtagt
caatctgagcaattttgtcaacgccttggccggtaccgcatgccctttgcttggactgcc
atccacttaatgaatattgtcaacagcgccggcagtctcgagagagatactgagctggag
atgagcctttcagagagaaagggatcatggtcagaacgacggaactcaagcatcatggga
aggcggtctttggaaagaaccaccagtggagatgaatcatgtagtctgactggttttaga
cctgccaccttaaccatcaccaacttcttcaaacaggagggtgataggctgagtgatgag
gacttatacaagtttcttgctgatatgagaagaccttcttcagtgttgaggagactgaga
cccataacagcccagttgaaattggacatttctccagctccagagaacccccactattgc
ttgacacctgacctcttgcaagttaaaccttacccagacagtagagtgcgccccaccagg
gacatcttggagtttcctgccagggatgtatatgtgccaaacactacatacagaaatctg
ctgtatgtgaacccgcagagtcttaacttcgccaatcgccaaggctcagcccgcaacatt
acagtgaaagtgcaattcatgaatggagaagatccgaataatgctatgcaggtgatattt
gggaagtcaagctgtgctgatttctacaaagaggcctatacgtcggtggtctaccacaat
cgatcccctgactttcacgatgagatcaagatcaaactccctgcctccctatcggaccac
caccacattctcttcaccttctaccacgtcagctgccagcaaaagcagaacacgctgctg
gagacccctgtgggatacacgtggatacccatgttgcagaatggacgtttgcggactggg
cacttctgtcttcctgtttctctggaaaaaccaccacagtcctactctgtactttcacca
gatgttcctctcccaggaatgaagtgggtggacaaccatcgtggggtattcaatgtggag
gtagttgccgtttcaactatccacacacaggatcagtacttggataagttctttgcattg
gtgcatgcactggatgagcacatgttcccagtccggataggggacatgagaatcatggaa
aacaacttggaaactgagctgaagtcaagtatagcagcactcaactcttcccagctggag
ccagtcgttcgatttcttcaccttctacttgacaaattggttttgcttgtggttcgacct
ccagtcattgctggacaaatcgtcaatcttggtcagtcatcatttgaggttatggcagcc
attgtaaaccgcctccataagtacctggacaccagccaggacatgcatggccgcaacagc
ctgctttcttcatacatccactatgtcttccggttgcccagcactgaccccaactctcct
tcgccagatgtcaaatctacctcaacaggccctggagggcttggaggttctgttcactat
gccaccatggcccgctcagctgttcggccagccagccttaacctaaaccgctctcgtagc
cttagcaacagtaaccctgacatctccggtacgcccacctctcctgatgatgaggttcgc
gccatcatcggtagcaagggcttagaccggtccaactcgtgggttcacaccatgggctgt
aagagtgccccttggggatccagccctgggtctgctccagaaaccatgcaggccatggag
cgctgtggcaatcgcatgtcttcgcacacagagagcgccagtttcttgcaaactttaacg
ggacgattgcccacaaaaaagctctttcacgaggagctggctctccaatgggtggtgagc
agtggaagtgtcagggagggagctctacaacaggcctggtttttctttgagcttatggtg
aagagcattattcatcacctctacttcgctgaacgcctcgagtcacccagaaaaaacaga
ttcccggagcgctttatggatgacatcacagcgttggtcagcaccattgctggtgatatt
gtatcacgttttcagaaggatctggagctggttgagcgactgaatacaagtctcgctttt
ttcctcaatgatttgctctccgtcatggacagaggctttgtcttcacccttatcaaggcg
tactggaaacaggtgtccacaaaggtttatgctctgcaaaacccgacattagagtctctc
aggctggatttcttgagaatagtttgcagtcatgaacactatgtcaccctcaacctgcct
tgcagcttgctcacgccacctgcttccccatcaccgtctgtctcttcagcaacttcacag
agctctgggttctccacacatgttcaggaccaaaaaatagcaaacatgtttgaactgtcc
gtgcccttcagggagcaacactttatggctgggctggtactgtcagaactgtctgtgata
cttgacccagacaatgaggggatgtttggcttgcataaaaaagtggttagtgttgtccac
aacctattgtccagccatgactctgacccgcgctatgcagattcagaggtcaaagcccga
gttgctatgctgtaccttcctttgattggcattgtcatggagaccctgccgcagctccat
gacttcacagagtccctcaaccagtggggtcgatcaggtggcgtgcagggcaccactgtc
tgcagcaatggggatgatgctgaggcagagggaaacaacatgattaatcagactgttgcc
atggccatagctggcaccactactacctcgccaatgtcccgaccaagcagcttcttgttg
aattcgcaggcgaatcgtcagcacggaagcttctcggccgagtcaagtcgcagtctgctc
atctgtctgctgtgggtgcttaaaaatgcagatgagctggtgttgcagaagtggttcacc
gatctttcagtctcacagctgaaccgcctgttagatctcctctacctctgtgtttcttgc
tttgaatacaaggcccatgttgtgttcaccatgcaggggaagaaagcattcgagcgcatg
aacagtctgactttcaaaaagtcgaaagacatgaaggccaagctggaggaggccatcctg
gggagcatcggtgccaggcaggagatggtgcgacgcagccgtgggcagctagagcgtagt
ccttcaggcagtgcctttggcagccaggagaatctgcgctggagaaaagacatgacccac
tggaggcagaacagtgagagattagacaagagtcacagatcacacaggacaagagcagag
ttggagcatgaagcacttattgacggtaaccttgcgacagaggccaacttgatcattctt
gatactttggagatcattgtgcagaccgtatcggtgacagagtccaaagagagtatcctc
ggtggggtgctgaaagtgttgcttcacagtatggcctgtaatcaaagcgccctctacctt
cagcactgttttgctacacagcgagcacttgtgtcaaagtttcctgaactgctgtttgaa
gaggagacagagcagtgtgctgacctgtgcttacgactgctaaggagctgcagtagcagt
ataagcaccatcagggcccacgccagcgcatcactctacctcctcatgaggcagaacttt
gagattggcaacaattttgcaagggtgaagatgcaggtgacgatgtctctttcatcattg
gtgggaacatcccagaattttaatgaggagttcctgcgtcgctctctgaagaccatcctt
acttatgcagaggaggacctcgagcttcgggaaacaacttttccagaccaggtgcaagac
cttgtttttaacttgcacatgattctgtctgacacggtcaagatgaaggaacaccaggaa
gatcctgagatgctaattgatctcatgtacaggtactgtacaaagctgatgaatgttcag
gaaaatcaattttag

DBGET integrated database retrieval system