KEGG   Hippocampus comes (tiger tail seahorse): 109530571Help
Entry
109530571         CDS       T04969                                 

Gene name
otc
Definition
(RefSeq) ornithine carbamoyltransferase, mitochondrial isoform X1
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00220  Arginine biosynthesis
hcq01100  Metabolic pathways
hcq01230  Biosynthesis of amino acids
Module
hcq_M00029  Urea cycle
hcq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109530571 (otc)
Enzymes [BR:hcq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     109530571 (otc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 109530571
NCBI-ProteinID: XP_019749967
Position
Unknown
AA seq 356 aa AA seqDB search
MSLKYFACKSSISGRLKTFKNTILRGFRSGIAANCSVSLKGRSCLTWKDFTAEEIKKLLW
VSADLKHRFKHEKQYLPLLQGKSIAMIFEKRSTRTRMSTETGFALLGGHPCFLTAQDIHL
GVNESCADTARVLSGLCDIILARVSSHSTLEELDKESSIPVVNGLSDLDHPIQILADLLT
LQEHYGSLAGLTVSWIGDGNNVLHSFMMAAPKLGVHLKVATPKGYEPHQSIIEEAERLSK
KHSTQLMLTCEPTEAALHSDVLVTDTWVSMGQEEEKRKRLRDFHGYQITMQTGSVARPDW
TFLHCLPRKKEEVDDEVFYSSRSLVFPEAENRKWTIMGLMVSLLTDYKPQMPTLKF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaatattttgcctgtaaaagttccatttctggacgtttgaagacttttaaa
aacacaattttgcgtggatttaggagtggcatcgcagcgaattgcagtgtgagtttgaag
ggtcgcagctgtctgacatggaaagacttcaccgcagaagaaatcaagaagcttttatgg
gtgtctgctgatttaaaacatcgcttcaagcatgaaaaacagtatctgccccttctgcaa
gggaagtccatcgcaatgatatttgagaagaggagcaccagaacaagaatgtccacagaa
acaggctttgctttgctgggtggacatccttgtttcctcacagcccaagacatccatctg
ggagtgaacgagagttgcgccgacactgcgagggttctatcaggattgtgcgacatcatc
ctagctcgggtgtccagtcactccacacttgaggaactggataaggagagctccattccc
gtggtgaacggattgtcagacctcgaccacccaatccagattctggctgacttgctgacc
ttgcaggagcattatgggtccctggctggactaacagtgagctggattggagatgggaac
aatgtcctgcactctttcatgatggctgcacccaaattgggagtacacttgaaggttgct
acccccaagggttatgagccacaccaaagcataattgaagaagctgagagactctcgaaa
aagcacagtacccagctcatgctgacctgcgagccgacagaggcggctctccacagcgac
gttttggtgaccgacacctgggtgagcatgggccaggaggaggagaagagaaagagactc
cgagacttccacggttaccagattactatgcagacaggaagtgtagcccggcccgattgg
acttttttgcactgtcttcctcgcaaaaaggaggaggtggacgatgaagttttctactcg
tctcggtcactcgtcttccctgaggcagagaatcgcaagtggacaatcatgggtttgatg
gtgtcactcctgactgactacaaaccacagatgccaacgctcaagttttaa

DBGET integrated database retrieval system