KEGG   Hippocampus comes (tiger tail seahorse): 109530671
Entry
109530671         CDS       T04969                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hcq03021]
    109530671 (aff3)
Transcription machinery [BR:hcq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109530671 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 109530671
NCBI-ProteinID: XP_019750124
Position
Unknown
AA seq 1138 aa
MPTVLCSGRGKLSFGFLLHRCLLSQVIRGQHSCAKCIWGDMTQSWPTQQALAGDQGILFN
PLDGTQPTTEQRQGRGDAQPRMTHHPHVAPHKSMLVDDLRLSSDEDDVQKATHESASWEG
HSRSRKNGRRTRHSSSDSLQSHSTVESVSGSLHSRSSSPAAWPADAQSPCSSNKETDPST
TAQWQLDKWLRKSHKKAAHSDNYPTRSIPGNAPSPHTVQAPSPARCWDSNQEYSPSQRPI
PSPQLSYRPGSPLLSLDYSFCPSPLPSTCPSPSNSRYSPIVSPVPSVFPSPCGSPRAQHS
PKPNQRGPQLSPTLSPLGGYHYPELQSDLYPAPPPHRTKVRSKIGPLSNADAKTKHTNST
ELLPHQHRPKARSTEYRDHRQNKSKAVLNRSDSHRPQKHSHSSTKKPANHTSQSEEIQRS
RPGHSSDHRTRPPVQQHLPTGRETSAGQGPTAKAAGNNHSRPAPNLQPWAKSSAVNVNSC
KASHKQTRAKKREVVHRDVPHTEAEGRKDRRREDRNRTEERKEDRRLAEEQLLRHRWIQS
STEEEEEEVVVVEKQRRRPREKQQIRGCQTIQSKERHLHQDHAQPQRRTEKQTKQRGSSS
SLSPLAQGQSPSSFASSNSDSEYQTQVAKVPADSTSLHRLHRKCQNSSGRPDASKSREKT
SESPAAGQQRTTRHRLYTLVPFGRSEQAAAPSQRGLRNLVVHIDLCLLKRVPDSAVNCTF
KATNFSSSSSSSSSSSKTKDKQTEAMKHLCMADAVSKDSKRKRKLEIGVSHKESKRNTPH
AKDVTGRTESSSHVAERGVSTETVHNGYLEEYLDNKRPLSPLSPLSDSPETIELTSKAKN
GEVYHKNRDKNRVSALKPKKEVDCVKVSRKPLSDSWAAAGHRAAVPNTETPHHAEYYLHE
AKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYAETVELIRYAM
RLKSHSGPGARQEDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKTSPKVPLM
PSCWNDTGKDTGGPPPSLLPDATKHIQRGSHGDSASPSLISIPQRIHQMAANHLNITNSV
LYSYEYWEVADNLAKESKEFFNYLNTLSGPLTLHSSIVHAVQYTRQALQWIRISAKLN
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgcccactgtgctgtgcagtggcagggggaaactttcctttggctttttgctgcaccga
tgcttgttatctcaggtaataagaggccaacacagctgtgccaaatgtatttggggggac
atgactcagtcgtggccaacccaacaagccttagcaggtgatcagggaatcctcttcaac
cctctggatggaacgcagccaacaacagaacagaggcaaggtcggggggatgctcagcca
cgaatgacccatcatccccatgtggcgcctcacaagtcgatgcttgttgacgatttaaga
ttaagcagtgacgaggatgacgtgcaaaaggcaactcatgaatcagcttcctgggaggga
cacagccggtcacgcaaaaatggcaggaggacgagacattccagctcagactccttgcaa
tcccactctaccgtggagtcggtcagcggcagccttcattcccggagctccagcccagct
gcttggcccgcagatgcacagtccccatgtagcagcaacaaggagactgatccctccaca
actgcccagtggcaattggataagtggctgaggaagtcccacaaaaaggcagctcatagt
gacaattatcccacccgtagcattcctggaaacgcaccctctccgcacacggtccaagcg
ccgtctccagcaagatgctgggacagcaatcaggaatacagccctagccagaggcccatt
cccagcccacagttgagctacaggcccggcagccccttgctgagtcttgattacagcttc
tgtccgagtccactccccagcacctgcccaagtccgagcaatagcaggtacagtcccata
gtgagtccagttccaagtgtatttccaagtccatgcgggagcccgagagcgcagcatagc
ccaaagccaaatcagagaggtcctcaattaagtcccactttatctcctttgggaggttac
cactaccctgagcttcaaagcgatctgtacccagcaccacctccccacaggacaaaagtt
aggtcaaagattggcccattgtctaacgctgacgccaaaaccaagcacacaaatagcaca
gagcttctccctcatcagcacaggcccaaggcgaggtccacagaatacagagaccacaga
caaaacaaatccaaagccgttttaaaccgcagtgatagtcacagaccacagaagcattcc
cattcaagcactaaaaagccagccaatcacacatcacaatccgaggagatccagaggagc
cgacccggccacagctctgaccacaggactcgacctccagttcaacagcatcttccaact
ggccgtgaaaccagcgccggtcaaggtccgaccgctaaagctgccggtaataatcactcc
agaccagctcctaacctacaaccgtgggccaaatcaagtgctgttaatgtgaattcttgt
aaagcatcacacaagcaaacacgggccaagaaacgcgaggtggtccacagagacgttcct
cacaccgaagctgaggggaggaaagacagaaggagagaggacagaaacaggacagaggaa
agaaaggaagacaggaggctggcggaggagcagctcctgagacatcgctggatccagagt
tctacagaagaggaggaagaggaggtggtcgttgtagagaagcagcggaggcggcctcgg
gagaaacaacaaatccgcgggtgccaaacaatccagtccaaagagcgacaccttcatcag
gatcacgcgcaaccccaaagaagaaccgagaagcagacaaagcagcgagggtcttcatct
tcactcagccctcttgctcaaggacagtccccctcatcctttgcttcgtcgaattccgat
tcggaatatcagacacaagtcgccaaggttccggcagactccacttcactccatagactc
cacaggaaatgccaaaacagctccggtagacccgatgccagtaagtccagggaaaagacc
tccgagagcccagccgcggggcagcagcgtacgaccaggcaccgactctacactttggtc
ccgttcgggcgaagcgagcaggccgcagccccttcccaacgtggactgagaaacctggtg
gtgcacatagacctctgtctcctcaagagggtcccggactccgctgttaattgtaccttt
aaagccactaacttttcctcctcctcctcctcctcttcttcttcttcgaagacaaaagac
aaacaaaccgaggctatgaaacatctgtgtatggcagatgctgtctccaaagacagcaaa
agaaaacgcaagttggagattggcgtctcacacaaagaaagcaagaggaacacgccacat
gcgaaagacgttaccggtcgcacagaatcatcatcgcatgtggccgagcgcggcgtttca
actgagaccgtgcataatggatatttggaagagtacttggacaataagcggccattatct
cccctgtcaccgttgtctgacagcccagagaccatcgaactcacatccaaagcaaaaaat
ggcgaggtttatcacaagaacagagataagaacagagtttcagcactaaagccaaaaaag
gaggtggattgtgtaaaagtgtccagaaaacctttgtcggactcctgggccgccgcagga
caccgagcagccgtgccaaatacagaaacgcctcaccacgccgagtactacttgcacgaa
gccaaaaggatgaagcaccgtgccgatgccatggtggacaaactgggcaaggctgtgaat
tacgtcgatgctgctctctcattcatggaatgtggcaaagcgatggaggaaggcccactg
gaggcaaaatccccctacaccatgtacgcggagacagtggagcttataaggtacgcaatg
aggctaaaaagccactctggtcctggagcacgacaagaagacaaacagctggctgtgctc
tgctttcgatgtctcgccctcctttactggcagatgtttcgtttgaaaaaggatcatgca
ctgaaatactccaaagtactgctcgactactttaagacttctcccaaagtgcctctgatg
ccatcttgctggaatgacaccggaaaggatactggaggccctcctccttcgctcctaccc
gatgccaccaaacatatccagcggggttcacatggggacagtgcctccccgtcacttata
agcatccctcaacgtatccaccagatggcggcaaaccacctcaacatcaccaacagtgtc
ctgtatagctacgagtactgggaggttgcagacaacctggctaaggagagtaaagagttc
ttcaactacttgaatactctatccgggccattgacgcttcacagcagcatcgttcatgca
gtccagtacaccaggcaagctcttcagtggatccgcattagtgccaaacttaactaa

DBGET integrated database retrieval system