KEGG   Hippocampus comes (tiger tail seahorse): 109531026Help
Entry
109531026         CDS       T04969                                 

Gene name
mgat2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00510  N-Glycan biosynthesis
hcq01100  Metabolic pathways
Module
hcq_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109531026 (mgat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hcq01003]
    109531026 (mgat2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     109531026 (mgat2)
Glycosyltransferases [BR:hcq01003]
 Glycan extension
  N-Glycan
   109531026 (mgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 109531026
NCBI-ProteinID: XP_019750599
Position
Unknown
AA seq 465 aa AA seqDB search
MRFRIYKRKVMILTVVVVICGLALWTSARQKKIEPFPKEAEVEALAKRSSGVSTSRNSLD
DHVRLQATVGVSRVPVAPLNQTRLEKIKDKENKAKPNVDNATLVYRGIVFQLNFDQTIRN
QEKFQAARQKDDLVVVVQVHNRPDYLKLLVDSLRGARGVESILLIFSHDYWSPEINNVVN
SVDFCQVLQIFFPFSIQLYPQEFPGNDPRDCPRDIPKKEALKLGCINAEYPDSFGHYREA
KFSQTKHHWWWKLHFTWDRVHVLRDHGGLVLLIEEDHFLSPDFIHVLKLMSALKREHCSD
CDILSLGSYSHIAYSSKANKVEVKAWKSTEHNMGMALSRDTYQKLLGCTDTFCTYDDYNW
DWSLQHLTVSCLPSYWKVMASEAPRVFHAGDCGMHHKKTACMPASQKSKIENILQGSGNQ
LFPKNLLITKRLPSNGAGGVAPHVKNGGWGDIRDHELCKSYVRLQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagattccggatctacaaaagaaaggtgatgatactgactgtggtggttgtcatctgc
gggctggcgttgtggaccagcgcgcggcagaagaagattgagccgttcccaaaggaagcg
gaggtggaggccctggcgaagagaagtagtggcgttagcacgagcagaaatagccttgac
gaccacgtccggttgcaagccacggtcggcgtgagccgggttcccgtcgcgccgctgaac
cagacgcgcctggaaaaaataaaagacaaagaaaacaaagccaagcccaatgtggataac
gcgacgctggtgtaccgcggcatcgttttccagctcaattttgaccagacgataagaaat
caggagaagtttcaagcggcgcggcagaaggacgacctggtggtggtggtccaggtccac
aaccggcccgattacttgaagctgctggtggacagcttgcgcggggcccgtggcgtggaa
agcatactgctgatattcagccatgactactggtcccccgagattaacaacgtggtgaac
tcggtggacttctgccaggtcctgcagatcttcttcccgttcagcatccagctgtacccg
caggagtttcccggcaacgacccgagggactgtccgagggacattcccaaaaaagaggcc
ttaaagttggggtgcatcaatgcggagtacccggactcgttcgggcactaccgcgaggcc
aagttctcccagaccaagcaccactggtggtggaagttacactttacgtgggatcgagtg
cacgtcctccgggaccacggcggtttggtgctgctgatcgaggaggaccacttcctgtcc
ccggactttatccacgtgctgaagctgatgtcggcgctaaaacgagagcactgtagcgac
tgcgacatcctgtcactggggagctacagccacatcgcctactccagcaaagccaacaag
gtcgaggtgaaggcctggaagtccaccgagcacaacatgggcatggcgctgagtcgggac
acctaccagaagctgctcggctgcacggacacgttctgcacctacgacgactacaactgg
gactggtccctgcagcacctgaccgtgtcctgcctgccgtcctactggaaggtgatggcc
agcgaggcgcctcgcgtcttccacgccggcgactgcggcatgcaccacaagaagaccgcc
tgcatgccggccagccagaagagcaagatcgagaacatcctgcagggcagcggcaaccag
ctgttccccaagaatctcttgatcaccaagcggctgccgtccaacggggccggaggcgtg
gccccgcatgtgaagaacggggggtggggggacatcagggatcacgaactttgcaagagt
tatgtgcgattacagtga

DBGET integrated database retrieval system