KEGG   Hippocampus comes (tiger tail seahorse): 109532694Help
Entry
109532694         CDS       T04969                                 

Gene name
tspan12
Definition
(RefSeq) tetraspanin-12 isoform X1
  KO
K17355  tetraspanin-12
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    109532694 (tspan12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 109532694
NCBI-ProteinID: XP_019753250
UniProt: A0A3Q2XFY5
Position
Unknown
AA seq 280 aa AA seqDB search
MARQDAVRCVRLFLYALNVLFWLMSACILGVAAWIRDSLNAVLTLTAHTRLEEAAVLTFA
PVVHPVLVVVCCFLLMVAMLGVCGTLRCDLMMLSWYFGSLLVILCVELASALWTYEQPPV
QRSDMISLKFRMSNFGLRQHQWLTHTWNTFQTEFECCGVTYFTDWLEMTEREWPPDSCCS
NQYPGCARRAHQHDLSDLHQEGCGPKLLSFIRSSAPLQLLRFLGVALGVAQILAMALTLT
LLWTLHYGRKRPKEPRGSPAAGVVAPAHGPPAEQHLRALC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcaggacgccgtgagatgcgtgcgcctttttctctacgcgctcaacgtgcta
ttctggttgatgtccgcgtgcattctgggagtggcggcgtggattcgagattccctgaat
gctgtcctgactctgaccgctcacaccaggctggaggaggctgcggtgctgacatttgcc
cccgtcgtccatcccgtcctggtggttgtgtgttgctttctgctgatggtggccatgttg
ggcgtgtgcggcactctgcgctgtgacctcatgatgctgtcctggtactttggaagtctg
ttggtcatcttgtgcgtggagttggccagcgctctgtggacctatgagcagccgcccgtg
cagcgctcagacatgatcagtctcaagtttcggatgtcaaacttcggccttcgccagcat
cagtggctcacacacacctggaacacctttcagacggagtttgagtgctgcggagtgacg
tactttacggactggctggagatgacagagagggagtggcctcccgactcgtgctgctcc
aatcagtacccaggatgcgctcggcgagcccaccagcacgacctcagcgatctccaccaa
gagggctgcggtccaaagctgttgtctttcatccgctccagcgcgccgctgcagctgctg
cgcttcctgggcgtggccttgggcgtggcccagatcctggccatggccctgaccctcacc
ctgctttggacgcttcactacggacgcaagcggcccaaagagccacgggggtcgccggcg
gcgggcgttgtcgcgccggcccacggcccacccgctgaacagcacttacgcgcactgtgc
taa

DBGET integrated database retrieval system