KEGG   Halomonas campaniensis: FF32_01540Help
Entry
FF32_01540        CDS       T03198                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
hcs  Halomonas campaniensis
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FF32_01540 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIA73566
UniProt: A0A060B939
Position
complement(336172..336549)
Genome map
AA seq 125 aa AA seqDB search
MSALAIEVSVVPEYRVAESDDSESRFVFSYTVTVHNQSPHSVQLMARYWKITQGNGDSQE
VRGKGVVGQQPLIGPGQRFRYTSRAILQTPVGVMEGAYTLLNTYTQRAFEVPIAPFRLAV
PRQLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccctagccattgaggttagcgtcgtgcctgaataccgtgtagccgagtcagat
gatagtgagtcgcgcttcgtgtttagttacaccgtgacggtgcataaccaaagccctcat
agcgtgcagcttatggcgcgctactggaaaattacccaaggtaacggtgatagccaagag
gtgcgtggcaaaggggtggtgggccagcagccgttaattggcccggggcagcgttttcgc
tacaccagtcgagccattctgcaaacgccggtaggcgttatggaaggcgcttacacgtta
cttaacacctacacccagcgagcttttgaagtgcccattgcgcctttcaggctagcggtg
ccgcgtcagcttcactga

DBGET integrated database retrieval system