KEGG   Halomonas campaniensis: FF32_03680Help
Entry
FF32_03680        CDS       T03198                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00280  Valine, leucine and isoleucine degradation
hcs00410  beta-Alanine metabolism
hcs00562  Inositol phosphate metabolism
hcs00640  Propanoate metabolism
hcs01100  Metabolic pathways
hcs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FF32_03680
   00562 Inositol phosphate metabolism
    FF32_03680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FF32_03680
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FF32_03680
Enzymes [BR:hcs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     FF32_03680
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     FF32_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AIA73967
UniProt: A0A060B4Y2
Position
complement(834208..835704)
Genome map
AA seq 498 aa AA seqDB search
MSVVSHLINGELIDSQRTLDVTNPSTGQVIRQVADASAADVERAIAAAQAAFPAWRDTPP
AKRAQVMYRFKQLLEEHADRLVQLVSEEHGKTPEDAMGELRRGIENVEYACGVPELLKGE
YSHNVGPGIDAWSNFQPLGVVAGITPFNFPAMVPLWMYPMAIACGNTFILKPSEKDPSAA
MAVAELLQEAGLPKGVMNVVHGSREAVETLLDAKAVKAISFVGSTPVAEAIYSRGSAAGK
RVQALGGAKNHAVVLPDADLENAANTLMGAAYGSCGERCMAISVAVCVGDETADRLVETL
LPKIAELKVGPGTDKGLDMGPLVTAEHRDKVLGYIEDGIKAGASLVADGRELKIAGHEDG
YFVGGCLFDNVTTEMRIYQEEIFGPVLCVVRVGSLDDAMQLINDHEYGNGTCLFTRDGEA
ARRFTDGIEVGMVGVNVPLPVPVAYHSFGGWKRSLFGDLHAYGPDSVRFYTRRKAVSQRW
PSVSEATRAEFSFPTNQR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgtttcccatctgattaacggtgaattaatcgacagccagcgcacgctggat
gtgaccaatccctcaacgggtcaagtgattcgccaagtggcggacgccagcgccgccgac
gtagagcgggctattgccgccgcccaagctgcgtttcccgcttggcgagatacgccacct
gctaagcgcgcccaagtaatgtaccgcttcaagcaactgctagaggagcacgccgaccgc
ttggtgcaattggtcagtgaagagcacggtaaaacccctgaagatgcgatgggcgaactg
aggcgcggcatcgaaaatgtcgagtatgcctgcggtgtgcctgagctattaaaaggcgag
tattcccataacgttgggccgggcattgatgcgtggtccaatttccagccattgggcgta
gtggccggcattaccccgtttaacttccctgccatggtgccgctgtggatgtatccgatg
gcgattgcttgcggcaatacctttattctcaagccttcggaaaaagacccttcagcagcg
atggcggtagccgagctgttgcaagaagctgggctgccaaaaggcgtgatgaatgtggtg
cacggtagtcgcgaagcggtggaaacgctgctagatgctaaggccgttaaagccatctca
tttgttggctcaacgccggtagcagaagctatctattcccgtggttcggccgctggcaaa
cgcgttcaggctctgggtggggcgaagaaccatgccgtggtgcttccagacgccgatttg
gaaaacgccgccaatacactgatgggggcggcttacggaagttgtggtgagcgctgcatg
gcgatttcggtggcggtgtgcgtgggtgacgagaccgcagatcggttagttgaaacgctg
ctgcctaaaattgctgagctcaaggttggtcctggtaccgataaaggcttggatatgggc
ccgctggtgacggcagagcaccgtgataaggtgttgggctatatcgaagacggcataaag
gcaggcgcgtcgctagtggccgatggccgtgagctgaaaatcgcgggtcatgaagatggc
tatttcgttggtggttgcctgttcgataacgttactaccgagatgcgcatttaccaggaa
gagattttcgggccagtgctgtgcgtggtgcgggtcggcagcttagatgatgctatgcaa
ttgattaacgaccatgaatatggcaatggcacctgcctgtttactcgcgatggcgaggct
gctcgacgctttaccgatggcatcgaagtgggcatggtgggtgttaacgtaccgcttccc
gtgccggtggcctaccatagctttggcggctggaagcgctcgttgtttggcgaccttcat
gcctacggccctgactctgtgcgcttctacacccgtcgaaaagcggtttcccagcgctgg
ccttcggtgagcgaagccacacgagccgagttttcgtttcccactaaccaacgttga

DBGET integrated database retrieval system