KEGG   Halomonas campaniensis: FF32_10640Help
Entry
FF32_10640        CDS       T03198                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00430  Taurine and hypotaurine metabolism
hcs00620  Pyruvate metabolism
hcs00640  Propanoate metabolism
hcs00680  Methane metabolism
hcs01100  Metabolic pathways
hcs01120  Microbial metabolism in diverse environments
hcs01200  Carbon metabolism
Module
hcs_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FF32_10640
   00640 Propanoate metabolism
    FF32_10640
  09102 Energy metabolism
   00680 Methane metabolism
    FF32_10640
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FF32_10640
Enzymes [BR:hcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     FF32_10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIA75287
UniProt: A0A060B8Q6
Position
complement(2346789..2347973)
Genome map
AA seq 394 aa AA seqDB search
MNTPVLVINCGSSSIKYALIDSDPQAPRLAGIAERLGSSEARLKGKNGAGESFTQALPNA
DHAEALSAILKRLEGRVPGAVGHRIVHGGEHFTQAAMIDDSVIAAIETTAALAPLHNPAN
LAGIAATRHVFPDLPQVAVFDTAFHQTLPPRAYRYALPEALYTEHGIRRYGFHGTSHAYV
SQRAGELSSHGAGGWLTAHLGNGCSTSAIWNNQSLDTSMGLTPLEGLVMGTRSGDVDPGL
HAHLHRQLGWSINEIDNVLNKQSGLLGLSGLTNDMREVEDQALAGHKGAKLALEVFCYRI
AKSLAALSCALPRLDGVIFTGGIGENSPIVRRDVLALLPHFHFSLDEVANEATIRGKEGK
LDNTDHDGPEVWVIPTDEEGRIAMETRHCVETTK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaccggtgctggtcattaactgtggctcttcttctatcaaatatgcattgatt
gattctgaccctcaggcaccgcgcttagctggcatagcagagcgtttagggagtagcgaa
gcccgcttaaaaggcaagaacggcgcaggtgaaagctttacccaagccctgcccaatgct
gatcacgctgaagcactaagcgctatccttaagcgcctggagggtcgagtacccggcgca
gttggacaccgaattgttcacggcggcgaacacttcacccaggcagctatgattgacgat
agcgttatagccgcaatagaaaccacagcagcgctcgccccactgcataaccctgctaac
ttggctggcattgccgccacccggcacgtctttccagacttgcctcaggtagccgtgttt
gatacggcctttcaccagacactaccgccccgcgcctaccgctatgccctaccggaagcg
ttgtacaccgagcacggcatccgtcgctacggcttccatggcactagtcatgcgtatgtc
agtcagcgcgcgggcgaactaagtagccacggtgcaggaggttggttaaccgctcacttg
gggaacggctgctctactagtgctatatggaacaatcaaagcctggataccagcatggga
cttacgccgttagagggcttagtgatgggaacccgcagcggcgatgttgaccctggcttg
cacgctcaccttcaccgccagcttggttggtcaataaatgagatcgataacgtactcaac
aagcagagtggtttgctgggcctctccggcctaaccaatgatatgcgtgaagtagaagac
caagcactggctggccataaaggtgccaaactggcgctagaggtattctgttaccgcatt
gctaaatcgttagccgccctctcttgcgccttacctcgactcgatggcgttatttttacc
ggcggcatcggcgaaaactcaccgatcgttcgccgtgacgtactggcgctactgccccac
ttccatttcagtttagatgaagtggctaacgaagccactattcggggcaaagaaggcaag
ctagacaacaccgaccacgatggccccgaagtgtgggtaattcctacggatgaagagggt
cgtatcgccatggaaacccgccactgcgtggagacgactaaatga

DBGET integrated database retrieval system