KEGG   Halomonas campaniensis: FF32_12470Help
Entry
FF32_12470        CDS       T03198                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00071  Fatty acid degradation
hcs00072  Synthesis and degradation of ketone bodies
hcs00280  Valine, leucine and isoleucine degradation
hcs00310  Lysine degradation
hcs00362  Benzoate degradation
hcs00380  Tryptophan metabolism
hcs00620  Pyruvate metabolism
hcs00630  Glyoxylate and dicarboxylate metabolism
hcs00640  Propanoate metabolism
hcs00650  Butanoate metabolism
hcs00900  Terpenoid backbone biosynthesis
hcs01100  Metabolic pathways
hcs01110  Biosynthesis of secondary metabolites
hcs01120  Microbial metabolism in diverse environments
hcs01130  Biosynthesis of antibiotics
hcs01200  Carbon metabolism
hcs01212  Fatty acid metabolism
hcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FF32_12470
   00630 Glyoxylate and dicarboxylate metabolism
    FF32_12470
   00640 Propanoate metabolism
    FF32_12470
   00650 Butanoate metabolism
    FF32_12470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FF32_12470
   00072 Synthesis and degradation of ketone bodies
    FF32_12470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FF32_12470
   00310 Lysine degradation
    FF32_12470
   00380 Tryptophan metabolism
    FF32_12470
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FF32_12470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FF32_12470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FF32_12470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcs04147]
    FF32_12470
Enzymes [BR:hcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FF32_12470
Exosome [BR:hcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FF32_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIA75622
UniProt: A0A060B9L0
Position
2728847..2730034
Genome map
AA seq 395 aa AA seqDB search
MQLDSVVIVSGARTAIGGFGGSLSSFAPHELGTITAQEALRRAGVAGADIDHSVYGHIIT
TSPEDAYLARHIALSAGVPKEAGAFNVNRLCGSGVQAVISAAQQIALGDSRLALAGGAES
MSRGAYLLPPQARNGIRLGDANIQDLTLGILSDPFGSGHMGMTAENIAKQYGLSREQLDQ
FAVDSHRKAAKAIAEGRFDAQIVPVEVTKGKQTVSFARDEHVREGVELSDLARLKPAFKK
EGIVTAGNASGINDGAATLVLAHADEAQQRNLTVRARLRVATTAGVEPSVMGLGPIPAVK
RCLQQAGLTINDIDVIESNEAFAAQAMAVADTLGFPLEKLNPNGGAVALGHPVGATGAIL
ILKALHELERRQGRYGLITLCIGGGQGIALLIERE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggatagcgttgttattgtaagcggtgctcgcaccgctattggcgggtttggt
gggtcgctctcatctttcgcgccccatgagttaggcactatcactgcccaggaagcacta
cgccgtgcgggcgttgctggcgctgatatcgaccactctgtgtatggccatattattacc
actagcccagaagatgcctaccttgcccgtcatattgcgttgagtgcgggtgtgccaaaa
gaagccggtgcctttaatgttaaccggctatgtggttccggcgtgcaggcagtgatatcc
gctgcgcagcaaatcgctctgggcgacagccgcttagcattggcaggtggggctgaatcc
atgtcgcgaggtgcttatctactgccgccccaagcacgcaatggcatacgcctaggcgat
gccaatatccaggatcttaccctcggtattcttagtgacccatttggcagcggacatatg
ggcatgaccgctgaaaatatcgctaagcagtatggcttaagtcgcgagcagctcgatcag
tttgcggtggatagccatcgtaaggcggcaaaagccattgcagaagggcgttttgacgcg
caaatcgtgcctgttgaggtgacaaaaggaaaacagacggtttcctttgcccgtgatgag
catgtgcgagaaggtgttgaattaagcgatttagcccggcttaaaccggcctttaaaaaa
gagggaatagtaacggcaggaaacgcctctgggatcaacgatggcgctgcgaccttggtg
ctggcgcatgctgatgaagcacagcagcgcaatttaacggtgagggcgcgacttcgcgtg
gcaaccaccgccggtgtggagccttcggtaatggggttagggccaatccctgcggtgaaa
cgctgcctccaacaggcagggctgacgatcaatgacattgatgtgattgagtccaatgaa
gcgttcgcggcacaagcaatggcggttgccgatacgctgggtttcccattggaaaaactc
aacccgaatggtggtgcggtggcgctcggtcatccagtaggcgcgaccggtgccatcttg
atcctaaaagccttacacgaattggagcgacgtcagggccgctatggtttgatcacgctg
tgtatcggcggtgggcagggcattgcgctgttaatagagcgcgaataa

DBGET integrated database retrieval system