KEGG   Halomonas campaniensis: FF32_13540Help
Entry
FF32_13540        CDS       T03198                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FF32_13540
Enzymes [BR:hcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FF32_13540
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FF32_13540
    1.1.1.-  
     FF32_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N NAD_binding_3 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AIA75826
UniProt: A0A060BFE6
Position
2952567..2953616
Genome map
AA seq 349 aa AA seqDB search
MQAAVWYAAKDLRVEQMPIPTINDPHEVKVKVAACGICGSDLHEYAAGPIFIPVDKPHPI
SGEQAPIIMGHEFAGEVVEVGDKVTRVKVGDRVAIEPILSPNQNGAYQMERYNLTPLLGF
HGLSGGGGGFSEFTVMGEHMVHKLPDDLSFEQGALVEPAAVALHAVRQSSLKAGDSAAVF
GAGPIGLMTIEALKAAGAAQIYAVEVAPSRKAKAEALGAIVVDPQQEDAVAKLQMLSNGG
VDVAFEVTGIPAVLNQSLHSTHEGGEVIVVSIWEGEASFHPNDLVIKERTMKGIIAYRHV
YPAVMALMQRGYFRAEDMVTQRIPLADIVEEGFEALLSDKAQVKIIVTP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcggtttggtatgcagcgaaagatctgcgtgttgagcaaatgccgataccg
acgattaacgaccctcatgaggtaaaagttaaggtggcggcgtgtggtatttgtggtagc
gatttgcacgaatacgccgctgggccgatttttattccggtcgataagccgcaccccatt
agcggtgagcaagcaccaattatcatggggcacgaattcgctggtgaagtggtagaggta
ggcgacaaagtaactcgggtgaaagtgggggatcgcgtcgctatcgagccgattctttca
cctaaccagaacggtgcttatcagatggagcgctacaacctcacgccactattgggtttc
catggcctttctggcggcggcggtggcttctcggagttcaccgtgatgggggagcacatg
gtgcataagctgccggatgacctcagcttcgagcaaggggcactggtagagccagcggcg
gttgctttgcatgccgttcgtcaaagtagtttgaaggcaggggatagcgcagcggtattt
ggcgcgggcccgattggcttaatgaccatcgaggcactaaaagcagcaggcgccgctcaa
atttacgccgtcgaggtagctccttcacgtaaagctaaggccgaagcgcttggtgctatc
gtagtggacccgcagcaagaagatgcagtggcgaagctacaaatgttgagcaacggtggc
gttgacgtagccttcgaagtgaccgggattccggccgtactgaatcagtctttgcacagc
actcacgaaggcggtgaagtaatcgtggtcagtatttgggaaggagaggccagtttccat
cccaacgatttggtcattaaagagcgtaccatgaagggcattattgcctatcgccatgtt
tatccggcggtaatggcactaatgcagcgaggctacttccgcgctgaagatatggtaacc
caacgcatcccgctagcagatattgttgaagagggattcgaggcactgttgagtgataaa
gcgcaggtgaaaataatcgtcacgccctag

DBGET integrated database retrieval system