KEGG   Haloterrigena daqingensis: BB347_01045Help
Entry
BB347_01045       CDS       T04679                                 

Definition
(GenBank) tyrosine decarboxylase MnfA
  KO
K18933  tyrosine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.25 4.1.1.11]
Organism
hda  Haloterrigena daqingensis
Pathway
hda00350  Tyrosine metabolism
hda00410  beta-Alanine metabolism
hda00680  Methane metabolism
hda00770  Pantothenate and CoA biosynthesis
hda01100  Metabolic pathways
hda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hda00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BB347_01045
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BB347_01045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB347_01045
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BB347_01045
Enzymes [BR:hda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     BB347_01045
    4.1.1.25  tyrosine decarboxylase
     BB347_01045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SHMT DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APX95306
UniProt: A0A1N6ZMK7
Position
209081..210166
Genome map
AA seq 361 aa AA seqDB search
MQREPQSFDRVLSSMCSEPHPLAREAAERFLATNPGDPGTYPTVTALEEEALATLGEIAG
LENPSGYIASGGTEANVQAVRIARNRAETRTPNVVMPESAHFSFQKAAGVLGVDLRIVPT
DERFRADLEAVRASVDADTALVVGVAGSTEYGRVDPIPALGEIARDAGAMLHVDAAWGGF
VLPFSGDEWHFGHAAVDTMAIDPHKMGQAAVPAGGLLARSDDLLDELAVDTPYLESTSQA
TLTGTRSGAGVASAVAAMDELWPDGYREQYRRSQENAEWLAAELEQRDYDVVEPTLPLVA
AEISGSTFEALREEGWRISRTARDELRVVCMPHVTREMLASFLEDLDRLERGASVPVASD
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgagccgcaatcgttcgatcgagtgctctcctcgatgtgttccgagccacat
cccctcgcacgcgaggcggccgaacgatttctcgcgacgaaccccggcgatccgggaacc
tatccaactgtgacggccctcgaggaggaggcgctcgccacgctgggcgagatcgccggt
ctcgagaacccgtcggggtacatcgcgagcggcgggacggaagcgaacgtgcaggcggtg
cgaatcgccagaaaccgtgccgagacgcggacgccgaacgtcgtcatgcccgagtcggca
catttcagttttcagaaggctgccggcgtgttgggcgtcgaccttcgaatcgtgccgacc
gacgagaggtttcgggcggatctcgaggccgttcgcgcgtccgtcgatgcggataccgca
ctcgtcgtcggcgtggccggatcgacggagtacggccgcgtcgatccgattccggcactc
ggtgagatcgctcgagacgcgggagcgatgctccacgtcgacgcagcctggggcgggttc
gtactcccgtttagcggggacgagtggcacttcggtcacgcggccgtcgatacgatggcg
atcgatccacacaagatgggccaagccgccgtccccgcgggcggtctgctcgcccgttcg
gacgacttgctcgacgaactcgccgtcgacacgccctacctcgagtcgacctcgcaggcg
acgctgacggggacgcgctccggcgcgggcgtcgcgagcgccgtcgccgcgatggacgag
ttgtggcccgatgggtatcgcgaacagtaccgtcgctctcaggaaaacgccgagtggctc
gccgcggaactcgagcagcgggactacgatgtcgtcgagccgacgctgccgctggtcgcg
gccgagatttcggggtcgacgttcgaggcgctgcgcgaggaggggtggcggatctcccga
accgcgagggacgaattgcgcgtcgtctgtatgccacacgtgactcgggagatgctcgcg
tcgtttctcgaggatctcgatcgactcgagcgaggggcgagcgttccagtcgcgagtgac
ggctga

DBGET integrated database retrieval system