KEGG   Haloterrigena daqingensis: BB347_05115Help
Entry
BB347_05115       CDS       T04679                                 

Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
hda  Haloterrigena daqingensis
Pathway
hda00250  Alanine, aspartate and glutamate metabolism
hda00260  Glycine, serine and threonine metabolism
hda00630  Glyoxylate and dicarboxylate metabolism
hda00680  Methane metabolism
hda01100  Metabolic pathways
hda01110  Biosynthesis of secondary metabolites
hda01120  Microbial metabolism in diverse environments
hda01130  Biosynthesis of antibiotics
hda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BB347_05115
  09102 Energy metabolism
   00680 Methane metabolism
    BB347_05115
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB347_05115
   00260 Glycine, serine and threonine metabolism
    BB347_05115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hda01007]
    BB347_05115
Enzymes [BR:hda01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     BB347_05115
    2.6.1.45  serine---glyoxylate transaminase
     BB347_05115
    2.6.1.51  serine---pyruvate transaminase
     BB347_05115
Amino acid related enzymes [BR:hda01007]
 Aminotransferase (transaminase)
  Class V
   BB347_05115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APX96050
UniProt: A0A1N6X4R5
Position
complement(1046484..1047686)
Genome map
AA seq 400 aa AA seqDB search
MSDADEAIDVAEIDELTPPDRTLMGPGPSDVHPRVLRAMSTPLVGHLDPSFVEIMNEVQE
LLRYTFRTDNQWTIPVSGTGSAAMEAAIGNVVEPGDTMLVPTNGYFGGRMASMARRAGGE
VVEVDAPWGEPLEPADVSDALAEHDPDVFGFVHAETSTGVLQPDVPELTGAAHDHDALVI
ADTVTSIGGVELRVDEWDIDVAYAGPQKCLSCPPGASPLTLSEEAMDKVLSREEDPRSWY
LDLSLLEGYWGNERAYHHTAPITNVYAIREALRLVAEEGIEQRWARHERLAGALKAGAEG
MGLEMNAPEEYWLPSLNAVRVPDGIDDGAVCSELIERYDLEVAGGLGDLAGEIFRIGCMG
HSARPENVIYVVTALGDVLESMGADVDPGAGVSATRNALK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgctgacgaggcgatagacgtcgcggagatagacgagttgacgccaccggat
cggacgctgatgggcccagggccgagcgatgtccatccacgcgtgctgcgagcgatgagc
acgccgctcgtgggccaccttgacccctcgttcgtcgagatcatgaacgaggtgcaggaa
ctccttcgctacacgttcagaaccgacaatcagtggacgatcccggtgtcgggaaccggc
tccgcggccatggaagctgccatcgggaacgtcgtcgagccaggagataccatgctcgta
ccgacgaacggctacttcggcgggcgaatggcgtcgatggcgcgtcgcgccggcggcgag
gtcgtcgaggtcgacgcgccgtggggcgaacccctcgagcccgcagacgtttccgacgcg
ctggcagaacacgaccccgatgtctttggcttcgttcacgcggagacgagtacgggcgtc
ctccagcccgacgttcccgaacttaccggggcggcccacgaccacgacgcgctcgtgatc
gccgacacggtcacctcgatcggtggcgtcgaactccgcgtcgacgagtgggacatcgac
gtcgcctacgcggggccacagaagtgtctctcctgtccaccgggcgcgagtccgctcacg
ctctctgaggaggcgatggacaaagtcctctcgcgcgaggaagatccgcgctcgtggtac
ctcgatctctccttgctcgagggatactgggggaacgaacgcgcgtaccaccacacggca
ccgatcacgaacgtctacgcgatccgcgaggcgctgcgactcgtcgccgaagagggaatc
gagcagcgttgggcgcgccatgagcgactcgccggcgcgttgaaagcgggcgcagaagga
atgggtctcgagatgaacgcgccggaggagtactggcttccgagtctcaacgccgtccgc
gttccggacggaatcgacgacggagcggtctgttcggaactcatcgagcgctacgacctc
gaggtcgcgggtgggttgggagacctcgccggcgaaatattccgcatcggttgtatggga
cactccgcacgcccggaaaacgtcatttacgtcgtgacggcgctgggtgacgtcctcgag
tcgatgggtgcggacgtcgaccccggtgcaggtgtctctgcgacgcgaaacgcactcaag
taa

DBGET integrated database retrieval system