KEGG   Haloterrigena daqingensis: BB347_14805Help
Entry
BB347_14805       CDS       T04679                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hda  Haloterrigena daqingensis
Brite
KEGG Orthology (KO) [BR:hda00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BB347_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APX97786
UniProt: A0A1N7EQL1
Position
3055924..3057132
Genome map
AA seq 402 aa AA seqDB search
MIETLLLVGILVAVFVGYNIGGATTGVSFGPAVGAHVLSKLGAAALMSVFFFLGGWIVGP
AVVETLGEDIVPGDILTLEAGIGVLFFIGLALFAGNLFGVPASTSMTAVGSIAGLGLATG
TLDWATMGEIVSWWIVAPIVAFWVSGVIGRYFYPQLNEWVAISRRETHLWVVDRSSTIPK
VSAAKGTDKREITGSLIVVGIGCYMAFSSGASNVANAVAPLVGSGALEFEDGVLATFSNM
EWGIILAGVAVTIGAFTIARRTLETMGNDITNLPLTAAVVVMTVSATIVTLLSAIGIPVQ
LVIVATMSIIGLGWGRATRTTTVTDAVRGSEQTSVSVGALTTEEEGEPAPEIGEEEAEDI
PKASDLFDPSTTARVILVQNFVPVLATLGAFLTFRFVPIFGF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagacactgttactcgtcggtattctcgtggccgtcttcgttggctacaatatc
ggtggagcgaccaccggtgtctcgtttggacccgctgtcggtgcgcacgtgctctcgaaa
ctcggagccgccgcgctgatgtcggtctttttcttcctcggcggctggatcgtcgggccg
gccgtcgtcgaaaccctcggcgaggacatcgtcccgggcgacattctgacgctcgaggcg
gggatcggcgtcctgtttttcatcggcctcgcgctgtttgcgggcaatctgttcggcgtt
ccggcctcgacgtcgatgaccgcggtcggttccatcgcggggctcggactggcgacgggg
acgctcgactgggccacgatgggcgaaatcgtctcgtggtggatcgtcgcgccgatcgtg
gccttctgggtgagcggcgtgatcggtcgctacttttatccgcaactcaacgagtgggtc
gctatttctcggcgcgagacccacctgtgggtggtcgatcgctcgtcgacgattccgaag
gtctcggcagcgaaggggactgacaaacgcgagattaccggctcgctgatcgtcgtcgga
atcggctgttacatggccttcagttcgggggccagcaacgtcgcgaacgccgtcgcgccg
ctcgtcggcagtggcgctctcgagttcgaggacggtgtcctcgcgaccttctccaacatg
gagtggggaatcatcttggccggcgtggccgtcaccatcggtgcgttcaccatcgccaga
cggacgctcgagacgatggggaacgatattacgaacctgccgttaacggcggcggtcgtc
gtcatgaccgtctcggcgacgatcgtgaccctgctctcggcgatcgggattccggtccag
ttggtgatcgtcgcgacgatgagcattatcgggctcgggtggggccgcgcgactcggaca
accacggtaacagacgccgttcgagggagcgagcagacgagcgtctcggtcggtgcactc
accacggaggaggaaggagaacccgcacccgaaatcggtgaggaagaagccgaggatatc
ccgaaggcgtcggatctgttcgatccgtcgacgactgcgcgagtgatcttagtccaaaac
ttcgtcccggtgctcgcgacgctgggcgcattcctaacgttccggttcgtcccgatcttc
ggcttttga

DBGET integrated database retrieval system