KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0023Help
Entry
HDEF_0023         CDS       T00911                                 

Gene name
gapA
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase A
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0023 (gapA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hde04131]
    HDEF_0023 (gapA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0023 (gapA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     HDEF_0023 (gapA)
Membrane trafficking [BR:hde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HDEF_0023 (gapA)
Exosome [BR:hde04147]
 Exosomal proteins
  Proteins found in most exosomes
   HDEF_0023 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACQ66799
UniProt: C4K839
Position
complement(19273..20265)
Genome map
AA seq 330 aa AA seqDB search
MSIKVGINGFGRIGRIVFRAAQERTDIEVVAINDLLKAEYMAYMLKYDSTHGRFKGTIDV
EGNDLVVNNKKVRVTSEQKPESINWGALGIDVVIEATGFFLKKEEATKHLNAGAKKVLIS
APPKDDTPMFVMGVNHNQYAGQKIVSNASCTTNCLAPLAKVVHDKFGIIEGLMTTVHATT
ATQRTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPSLNGKLTGMAFRVPTPNVSV
VDLTVRLEKPASYSEICDAIKAASEGELKGILGYVDEEVVSTDFNGEKLTSIFDKKAGIE
LNNHFVKLVSWYDNETGYSNKLLDLVAHIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaagtaggtattaatggttttggtcgtatcggtcgtattgtgtttcgcgcc
gctcaagaacgaactgatattgaagtcgttgcgattaacgatttgttgaaagcagagtac
atggcttatatgctcaaatacgactccactcacggtcgttttaaaggaacgatcgatgtt
gagggaaatgatcttgtcgtaaataataaaaaagtcagggtcacttcagaacaaaaaccc
gaatccattaattggggtgcattaggaatagatgtggtgatagaagccacgggattcttc
ttaaaaaaagaagaggcaaccaagcatcttaatgctggtgccaaaaaagtacttattagc
gcgcccccaaaagacgacacgccaatgtttgtgatgggcgttaaccataatcaatacgcg
ggacaaaaaattgtttcaaatgcctcttgcacaaccaactgcttagcacctttggcaaag
gttgttcatgataaattcggtattattgaaggcttgatgacgacggtgcatgcaacaaca
gcgacacaaagaacggttgatggcccttctgctaaagattggcgtggaggtcgtggggca
gcgcaaaatatcattccttcttccactggtgctgcaaaagcggtcggcaaagtcatccct
tctttaaacggaaaactcacaggcatggcttttcgtgtgccgacccctaatgtatctgtg
gtagatctcactgttcgtttagaaaagcctgcatcttattcagagatctgtgatgcaatc
aaagcagcttcagaaggcgaattaaaaggcatcctaggatatgtggatgaagaagtcgtc
tctactgatttcaatggtgaaaaactaacctcaatctttgataagaaggcgggtatagaa
ctgaacaatcattttgtgaaattagtgtcttggtatgacaatgaaacagggtactctaat
aaactgttagatttagtcgctcatataaagtag

DBGET integrated database retrieval system