KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0040Help
Entry
HDEF_0040         CDS       T00911                                 

Gene name
gnd
Definition
(GenBank) gluconate-6-phosphate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hde_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_0040 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_0040 (gnd)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     HDEF_0040 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     HDEF_0040 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH IlvN F420_oxidored 3HCDH_N NAD_Gly3P_dh_N APOBEC4_like 2-Hacid_dh_C DUF4350 NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: ACQ66815
UniProt: C4K855
Position
complement(41121..42533)
Genome map
AA seq 470 aa AA seqDB search
MRKQQIGVIGMAVMGRNLALNIENQGYSVSIFNRSHEKTDQVIEENPEKNLLPCYSLKEL
AESLATPRRILLMVQSGSATDDTIRALTPYLNQGDTLIDGGNSHYQDTIRRSEELLKQGF
YFMGVGVSGGEEGALKGPSIMPGGQKEAYELMAPMFKKIAAKAEGEPCVKYIGPNGAGHY
VKMVHNGIEYGDMQLIAEAYSLLKQGLNLKNFELSDIFKQWNQGELSSYLIEITADIFCK
KDEHGHDLIDFILDEAANKGTGKWTSQSALDLGIPLSLITESVFARYLSSLKTQRIAAAK
VLTGPKIQPFHGQKAEFIEKIRSALYLGKIVSYAQGFQQLQTASEKNDWNLNYGDIASIF
RAGCIIRARFLQKITEAYHQKPNISNLLLAEYFKKIADHYQQALRDIVSYAVQNGIPVPA
FSAAITYYDSYRSALLPANLIQAQRDYFGAHTYKRNDSGQAVFHTNWVTD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcaacagataggtgtcataggtatggcggtcatgggccgtaacctggcactt
aatattgaaaaccaaggttattctgtctccatctttaaccgttctcatgaaaaaacagac
caggttatcgaagaaaatccagaaaaaaatctgctcccttgttacagcttaaaagagctt
gcggaatcactggcaacacctcgccggatcctgctgatggtccaatcaggatccgcaaca
gacgacaccattcgcgcactgacgccatatttaaatcaaggagatactttaattgatgga
ggaaacagtcactatcaggacactattcgaagaagtgaagaattattaaaacaagggttt
tatttcatgggggtcggcgtctcaggaggtgaagaaggcgctttaaaaggcccctcgatt
atgccaggggggcaaaaagaagcttatgaattaatggctcctatgttcaaaaaaatcgcc
gcaaaagccgaaggagaaccttgtgtcaagtacatcggcccaaatggtgcaggtcattat
gtaaaaatggtgcataacggcatagaatacggggatatgcaactgattgctgaagcttat
tctttgttaaagcaaggcttaaacctcaaaaattttgagctatcagatatttttaaacaa
tggaatcaaggtgaacttagcagttatcttattgaaataacagcagatattttttgcaaa
aaagatgagcatggccatgatctcatagacttcatcctagatgaggccgccaacaaaggc
acaggtaaatggaccagtcaaagtgctttagatctcggaattcctttaagtctcataaca
gaatccgtatttgcgcgttatttatcctctttaaaaacacaaagaatcgcggcagctaaa
gtactaacagggcccaaaattcagccatttcacgggcaaaaagcagaatttattgaaaaa
atacgatctgctctgtatttaggaaaaatcgtttcttatgcgcaaggatttcaacaacta
caaacagcctctgaaaaaaacgactggaacttaaattacggcgacattgcgagtattttt
cgtgctggctgcattattcgcgctcgatttttacaaaaaataacagaggcttatcatcaa
aaaccaaacatttccaatctgttacttgcagaatatttcaaaaaaattgcggatcattat
cagcaggcattgcgtgatatcgtctcttatgcggtacaaaatggtattcccgttcccgct
ttttctgcggccatcacttactacgacagttatcgctcggcactattaccagctaattta
attcaggctcaaagagattattttggggcacacacttataaacgtaatgacagtggtcag
gcggtctttcatacaaattgggtaaccgattaa

DBGET integrated database retrieval system