KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0041Help
Entry
HDEF_0041         CDS       T00911                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00040  Pentose and glucuronate interconversions
hde00052  Galactose metabolism
hde00500  Starch and sucrose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDEF_0041 (galU)
   00052 Galactose metabolism
    HDEF_0041 (galU)
   00500 Starch and sucrose metabolism
    HDEF_0041 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0041 (galU)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HDEF_0041 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACQ66816
UniProt: C4K856
Position
complement(42595..43488)
Genome map
AA seq 297 aa AA seqDB search
MPQKLKAIIPVAGLGTRMLPATKAIPKEMLPVVDKPIIQYIVNESVLAGVKEIVLVTHSS
KNAIENHFDTSFELEAVLEARVKRQLLQEVQNICPSDVTIMHIRQGQAKGLGHAILCARP
IIGDAPFVILLPDVLLETPSVDCLKENLTCMMERFAETARSQIMVAPIPLEDVCKYGIAD
CGNVIVFPGQAALIKAMIEKPSPKDTPSHLAVVGRYVLSSDIWPLLEKTSPGAGGEIQLT
DAIDMLIETQPVEAFHMTGKWHDCGDKLGYMKAFVEYALRHETEGSAFLNWLKNQNF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaaaattaaaagcgattatccctgttgcaggattggggacccgcatgctgcct
gcgaccaaggcgattcccaaagaaatgttacctgtggtggataagcctatcattcaatac
attgtgaatgaatctgtattagcgggggtcaaagaaattgtgctggtcacccattcatca
aaaaatgcgatagaaaatcattttgatacttcttttgaactcgaagcagttttagaggct
cgagtaaaacggcaattattacaagaagtgcaaaatatctgcccatccgatgtcaccatc
atgcacatacgacagggacaggctaaaggactaggacatgccatactctgtgctcgcccc
atcataggggacgccccttttgtcatcctgctaccagatgtactcctggagacaccttct
gtggattgcttaaaagaaaatctcacctgcatgatggaacgctttgcagagacagcgcga
agtcaaattatggtcgcacctattcctctagaagatgtttgtaaatacggtatagctgat
tgtgggaacgtcattgtttttccaggtcaggcggctttgataaaagccatgatagaaaaa
ccttcaccaaaagacaccccctctcatttggccgtggtaggccgttatgttttatcctca
gacatttggcccctactggaaaaaacctcgcccggggcggggggagaaattcaacttacc
gatgccattgatatgttaatagaaacacaacctgtggaagcctttcatatgactgggaaa
tggcatgactgcggcgacaaactaggttatatgaaagcttttgtagagtacgctctgcgt
catgaaacagaaggctccgcatttttaaattggttaaaaaatcaaaatttttaa

DBGET integrated database retrieval system