KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0049Help
Entry
HDEF_0049         CDS       T00911                                 

Gene name
pgi
Definition
(GenBank) glucosephosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00030  Pentose phosphate pathway
hde00500  Starch and sucrose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0049 (pgi)
   00030 Pentose phosphate pathway
    HDEF_0049 (pgi)
   00500 Starch and sucrose metabolism
    HDEF_0049 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0049 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0049 (pgi)
Enzymes [BR:hde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     HDEF_0049 (pgi)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HDEF_0049 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   HDEF_0049 (pgi)
  Exosomal proteins of colorectal cancer cells
   HDEF_0049 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ACQ66824
UniProt: C4K8I7
Position
50492..52138
Genome map
AA seq 548 aa AA seqDB search
MKKINPTQTSAWKALQQHFKEIEPIHIRHLFHADPKRSEKFSLTFNDLIRVDFSKNRLTA
QTIEKLQALAQETDLALAICSMFSGGKINETEERPVLHIALRNRGNQPILVDGQDVMPLV
NAVLEKMKRFCHQVIKGDWNGYSGQTITDVVNIGIGGSDLGPYMATEALKPYKNHLKMHF
VSNVDGTDIVETLKALNPARTLFIVASKTFTTQETMTNAQTAREWFLKTAGDSAHVARHF
VALSTNIKEVTNFGIDPENSFEFWDWVGGRYSLWSAIGLPIALSIGFDNFEKLLEGAYEM
DQHFLKTDFTHNIPVILALIGIWYSHFFGAETEAVLPYDQYLHRFPAYLQQASMESNGKW
VDRDGKPVGYQTGSILWGEPGTNGQHAFYQLIHQGTKIIPCDFIAPVISHNAIGDHHHKL
LANFFAQTQALAFGKTEQEVQEELMAEGVFSEKATYLAPFKAFSGNRPTNSILLKQITPL
SLGALIALYEHKIFTQGVILNIFSFDQWGVELGKKLASGILSELEGPEKVSCHDSSTNSL
INCFKKWH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatcctactcagacatctgcctggaaagctttgcagcagcactttaaa
gaaatagaacccattcatatcagacatctgtttcatgcggatcctaaacgctctgaaaaa
ttttctctcacttttaacgatctcatacgggtagatttttctaaaaatcggctgactgcc
cagacaatcgaaaagcttcaagctttagcacaggaaacagacttggccctcgcgatttgc
tccatgttttctggtggaaaaattaatgaaacggaagaacgccccgtgctacatatcgcc
ctgcgtaaccgcgggaatcagccgattttggttgacggtcaagatgtgatgcctttggtc
aatgccgtgctggagaaaatgaagcgattttgtcatcaagtgatcaaaggcgattggaat
ggttatagcggtcaaaccattacagatgtcgtgaatattgggatcggcggatcagatttg
ggcccttatatggctacagaagcattaaaaccctataaaaatcatttgaagatgcatttt
gtttctaatgtggatggcacagatatcgttgaaacattaaaagcgcttaaccctgccagg
acgctctttatcgtggcttcaaaaaccttcaccactcaagaaaccatgacgaacgcccag
actgctcgtgagtggtttttaaaaacagcgggtgattcggcccatgtggcgcgacatttt
gtggctttatccaccaatattaaagaagtgactaattttggtatcgatcctgaaaatagt
tttgaattttgggactgggtaggagggcgttattctctttggtcggcgattggcttacct
attgctctgtctattggttttgataattttgaaaaactgctagaaggtgcttatgagatg
gatcagcattttttgaaaacggattttactcacaatattcctgtgatattagcgctaatt
ggcatttggtatagccatttttttggcgctgaaactgaagcggttctaccctatgatcag
tatttgcatcggtttcctgcttatcttcagcaagccagtatggaatcgaatggaaaatgg
gtggatcgtgatggaaaaccagtgggctatcaaacagggtcgattctttggggagagccg
ggtaccaatggtcaacacgcgttttatcaacttattcatcagggcacaaagatcattccc
tgtgattttattgcgcctgtcatcagccataatgcaataggcgatcatcatcataaatta
ttggcgaatttttttgctcaaacccaagcgctggcattcggtaaaacagagcaagaagtt
caggaggaattaatggctgaaggggttttttcagaaaaagcgacatatttggcacctttt
aaagcgttttctggtaatcgcccgacgaactctattttattaaaacaaatcacgcctttg
agtttaggtgctttaattgccttatatgaacacaaaatttttacgcagggcgtgatttta
aatattttttcttttgatcaatggggtgtagagctgggtaaaaaattagcttctgggatt
ttatctgagctagaaggacctgaaaaagtgtcttgccatgatagttcaacgaattcttta
atcaattgttttaaaaaatggcattaa

DBGET integrated database retrieval system