KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0053Help
Entry
HDEF_0053         CDS       T00911                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00051  Fructose and mannose metabolism
hde00562  Inositol phosphate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0053 (tpiA)
   00051 Fructose and mannose metabolism
    HDEF_0053 (tpiA)
   00562 Inositol phosphate metabolism
    HDEF_0053 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0053 (tpiA)
Enzymes [BR:hde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HDEF_0053 (tpiA)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HDEF_0053 (tpiA)
  Exosomal proteins of bladder cancer cells
   HDEF_0053 (tpiA)
  Exosomal proteins of melanoma cells
   HDEF_0053 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACQ66828
UniProt: C4K8J1
Position
complement(55476..56243)
Genome map
AA seq 255 aa AA seqDB search
MRRSLIMGNWKLNGSLSMLAEFITSLSDQIDALKMCDIAIAPPAVYLHEAKKQLKNDRIS
LAAQNVDFNTGGAFTGELSPQMLKEVGAKYVIIGHSERRSYHQETNEGIAKKFALLKETG
LIPVLCIGESETENAQGLTQTICAKQLDAILAKCGPDAFKNSVIAYEPIWAIGTGKAATA
SEAQKVHAFIRQHVSKGKDEIAKTVIIQYGGSVNASNADEFFAEKDIDGALVGGASLKVN
DFLKIAQSAVAAKTF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgttctttaattatgggaaattggaaattaaacggcagcctttctatgctggct
gaattcatcacaagcttaagcgatcaaatagacgcgttaaaaatgtgtgacattgcgatt
gcgccgccggcggtttacttacatgaagccaaaaaacagcttaagaatgatcgtatttct
ttggccgctcaaaatgtcgattttaataccgggggcgctttcactggtgaactctctcct
cagatgctcaaagaggtcggcgcaaaatacgtcatcattgggcattccgaacgccggagt
taccaccaggaaacgaatgaagggatcgcaaaaaaatttgccttattgaaagaaacgggt
ttgataccggtgctctgtattggcgaatctgaaactgaaaatgcacagggattgacccaa
acaatctgcgcaaaacagcttgatgccatattagcaaaatgtgggccagacgcctttaaa
aactcagtaattgcttatgagcccatttgggcaataggcacaggaaaagcggccacggca
tctgaggcccaaaaagttcatgcgtttattcgccagcatgtctccaaaggaaaagatgag
atcgccaaaacagtgattattcaatatggcggttccgtaaacgcctctaacgccgatgaa
ttttttgctgaaaaagacattgatggagcattggttggtggtgcgtcattaaaagtgaat
gattttttaaaaattgctcagtccgccgtggctgcaaaaacgttttaa

DBGET integrated database retrieval system