KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0066Help
Entry
HDEF_0066         CDS       T00911                                 

Gene name
cyoE
Definition
(GenBank) protoheme IX farnesyltransferase (heme O biosynthesis)
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00190  Oxidative phosphorylation
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_0066 (cyoE)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_0066 (cyoE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hde01006]
    HDEF_0066 (cyoE)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hde03029]
    HDEF_0066 (cyoE)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     HDEF_0066 (cyoE)
Prenyltransferases [BR:hde01006]
 Compound prenylation
  Protoheme farnesyltransferase
   HDEF_0066 (cyoE)
Mitochondrial biogenesis [BR:hde03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    HDEF_0066 (cyoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA YwiC
Motif
Other DBs
NCBI-ProteinID: ACQ66841
UniProt: C4K8K3
Position
complement(66701..67573)
Genome map
AA seq 290 aa AA seqDB search
MIKPYINITKPGIIFGNLISFIGGFFVAAKGAINWPLFLGSLFGVSCVIASGCVFNNYID
RDIDKIMERTKNRVLVKGLMSPEISLIYASVLGLSGLFLLYMTTNRLTVLLAAMGFVIYV
FVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCTVTAQFDMGAFILLLLFALWQMPHSYAIG
IFRFKDYQAANIPVLPVVKGIFITKNHIIFYIFAFMIATLMLTLMGYTGYLFMLTSVVLN
GMWLIMAFKGYKASNDSQWAKSIFIFSIVIISSLSMMMSLDFLISKMIGD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgataaagccatatatcaacatcactaagccaggcattatttttgggaatctcatttct
ttcatagggggattttttgtcgcggcaaaaggggccatcaattggcctctttttttaggt
agtctttttggggtttcctgtgtgattgcctctggttgtgtcttcaataattacattgat
cgtgacatcgataaaatcatggagagaaccaaaaatcgcgttttggtgaaagggctgatg
tctcctgaaataagcctgatttatgcatcagtgctcggtttatcaggtctttttttactt
tacatgaccactaataggttaacggtgttattggccgcgatgggctttgtgatctatgtg
tttgtttatagtctttacatgaagcggcacagcgtttatggcactctgataggcagttta
tcgggcgcagcgcctcctgtcatcggttattgtactgtgacggctcaatttgatatgggg
gcttttatcttgctattgctcttcgctttatggcaaatgccgcattcttacgcgataggt
atctttcgttttaaggattatcaggcggcaaacattcctgttttacccgtcgtgaaaggg
atattcattacaaaaaatcacatcattttctatatttttgcctttatgatagctaccctc
atgctgacattaatgggttatacaggctatttatttatgctgacctccgtcgtcctaaac
ggtatgtggcttatcatggcattcaagggttataaagccagcaatgacagtcaatgggca
aaaagcatttttattttttcgatcgttatcatcagctcgctgagtatgatgatgtctctt
gattttttgatatcaaaaatgatcggggactaa

DBGET integrated database retrieval system