KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0072Help
Entry
HDEF_0072         CDS       T00911                                 

Gene name
accC
Definition
(GenBank) acetyl CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00620  Pyruvate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDEF_0072 (accC)
   00640 Propanoate metabolism
    HDEF_0072 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0072 (accC)
Enzymes [BR:hde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HDEF_0072 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HDEF_0072 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACQ66847
UniProt: C4K8L0
Position
complement(72874..74217)
Genome map
AA seq 447 aa AA seqDB search
MFDKIVIANRGEIALRILRACKELGIKTVAVHSTVDRDLKHVLLSDESVCIGEAPAPKSY
LNIPALISAAEITGADAIHPGYGFLAENADFAEQIECSGFVFIGPKAETIRLMGDKVSAI
NAMKKAGVPCVPGSDGPLGEDNIQNSRFAERIGYPVIIKASGGGGGRGMRVVHTDKDLAQ
AISMTRAEAKAAFNNDMVYMEKYLENPRHIEIQVLADKHGNAIYLAERDCSMQRRHQKVL
EEAPAPGITHGMRRQIGERCVQACQDIGYHGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGIDLVKEQLRVAVGHRLSFQQNDVVVRGHSLECRINAEDPNTFLPSPGKIMRLHVP
GGFGIRWDSHIYAGYTVPPDYDSMIGKLITYGETREVAIARMKNALSEVIIEGIKTNITL
QERIVNDDHFQRGGCNIHYLEKKSGSQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataaaattgtgattgctaatcgtggcgagattgctttgcgaattttacgcgct
tgtaaagaattgggtattaaaacggtggctgtacattcgactgttgatcgtgatctcaag
catgttcttttgtcagatgaaagtgtctgtatcggcgaagcgccagcccctaaaagttat
ttaaatattccagcactgatctctgccgcggaaatcacaggagctgatgccattcatcct
ggatatggttttttagccgaaaatgcagattttgcagagcagatagaatgctcaggtttt
gtttttataggacctaaagccgagactattcgtttaatgggagataaggtttctgccatc
aatgcgatgaaaaaagcaggtgtgccgtgtgttccaggctctgatggccccttgggcgaa
gacaatattcaaaatagtcgttttgcagagcgtattggatatcctgtgatcattaaggcc
tctggaggcggcggcgggcggggtatgagggtggtacacaccgataaagatttggcgcag
gccattagtatgactcgtgcagaggcgaaagccgcctttaataatgacatggtttatatg
gaaaaatatcttgaaaacccgcgccatatagaaattcaagttttagccgataaacatggc
aatgccatttatttggctgagcgtgactgttcgatgcagcgtcgtcatcaaaaagtcctt
gaagaggcccctgctcctgggattactcacggtatgaggcggcaaattggtgaacgctgc
gtacaagcctgtcaagatattggttatcatggtgctggcactttcgaattcctgtatgaa
aacggagagttctattttattgaaatgaatacccgtattcaggttgagcacccagtcact
gaaatgatcacgggcattgatttagtcaaagaacagcttcgtgttgctgtagggcatcgg
ctttcttttcaacaaaacgatgtcgtggtgcgaggccattctctcgagtgtcgtattaat
gccgaagacccgaatacgtttttacccagccccggaaaaataatgcgtcttcatgttcct
ggaggatttggtattcgttgggactcacatatttatgcaggttatactgtccctcctgat
tatgattccatgataggaaaactcattacttacggagaaactcgtgaagtggcgattgca
cgtatgaaaaatgccctttcagaagtgattattgaagggatcaagacgaatatcacatta
caagagcgaatcgttaatgatgaccattttcaaagagggggctgtaatattcattacttg
gaaaaaaaatcaggatcacaataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0073Help
Entry
HDEF_0073         CDS       T00911                                 

Gene name
accB
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein subunit
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00620  Pyruvate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDEF_0073 (accB)
   00640 Propanoate metabolism
    HDEF_0073 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0073 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACQ66848
UniProt: C4K8L1
Position
complement(74229..74666)
Genome map
AA seq 145 aa AA seqDB search
MDIRKIKKLIELVEEHDISELAISQGEESIRINRSLPTSTVAMVPAQYSRNSGVISEPET
KETSVSLEGHIIRSPMVGTFYRTPSPDASPFVEVGQTVSIGDTLCIVEAMKMMNQIQADQ
SGVIKAILIENAQPVQFNDPLFIME
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgaaaaattaaaaaattgattgaattggttgaagaacacgacatttcagag
ctggccatttctcagggtgaagagtcaatacgtattaaccggtcattaccgacttccaca
gtggcaatggtacccgcgcagtattccagaaattctggtgtcatttctgaaccagagacg
aaagaaacttctgtgtctcttgaaggtcatatcattcgttcccctatggtcggcactttt
tatcggacccccagcccagatgcgagccccttcgttgaagtcggccagacagtttcaatc
ggcgataccctttgtatagtagaggccatgaaaatgatgaatcaaattcaggcggatcaa
tcgggagtcattaaagccattttaatagaaaatgcgcagcccgttcaattcaacgaccct
cttttcatcatggaataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0208Help
Entry
HDEF_0208         CDS       T00911                                 

Gene name
accA
Definition
(GenBank) acetylCoA carboxylase, carboxytransferase alpha colanic acid synthesis
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00620  Pyruvate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDEF_0208 (accA)
   00640 Propanoate metabolism
    HDEF_0208 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0208 (accA)
Enzymes [BR:hde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     HDEF_0208 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HDEF_0208 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: ACQ66976
UniProt: C4K333
Position
complement(212091..213056)
Genome map
AA seq 321 aa AA seqDB search
MSLNLNFLDFEQPIVELEAKIDSLTAINRQDNPLNIDLDEEIQKLRDKSIQLTHKIFSHL
SAWQIAQLARHPNRPYTLDYIEHIFTDFEELAGDRHYGDDKAIVGGIARLNQKPVMVIGH
QKGRETKEKIRRNFGMPSPEGYRKALRLMEMAERFRLPLLTFIDTPGAYPGVGAEERGQS
EAIARNLREMSRLKTPIICTVIGEGGSGGALAIAVGDVVNMLQYSTYSVISPEGCASILW
KSADKASVAAETMGITAHRLKELKMIDTVLPEPLGSAHRDPKAMAESLKERLIKDLEYLK
QFDSLKLLDRRYEKLMSYGYC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaatttaaattttcttgattttgagcagcctattgtagagctggaagcaaaa
atcgattctttaaccgccattaaccgtcaagacaaccccctcaatattgatctagacgaa
gagatccaaaaattgcgtgataaaagtattcagctcacgcataaaatcttttctcatctt
tctgcctggcaaattgctcaactggctcgccatccgaatcgcccttatacgcttgattat
attgagcatattttcacggattttgaagaattagcgggtgatcgtcattatggtgatgat
aaggcgattgttggcggcattgcgcgcctgaatcaaaagcccgtcatggtgataggtcat
cagaaagggagagaaaccaaagaaaaaattcgacgtaattttgggatgccttctcctgaa
gggtatcgaaaagcgttgcgtttgatggaaatggctgagcgttttagattgcccctgttg
acttttatcgatacgcctggagcctacccaggtgttggcgccgaagaaaggggccagtct
gaagccatcgcgcgaaatttacgtgaaatgtcacgtttgaaaacgcctatcatttgcacg
gttattggtgaaggaggatctggcggtgctttggcgattgctgtgggtgatgtggtgaat
atgttgcaatacagtacttattctgtgatttcgcctgaaggctgtgcgtctattttatgg
aaaagcgccgataaagcctcagttgcagcagaaacgatggggatcaccgcgcatcgcctg
aaagaattaaaaatgattgataccgtactccctgaacctttgggaagtgcacaccgtgat
cccaaagcaatggcggagtcactcaaagagcgattgatcaaagatctggaatatttgaag
cagtttgattctttgaaattgcttgatagaaggtatgaaaaattaatgagttacgggtat
tgctaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0784Help
Entry
HDEF_0784         CDS       T00911                                 

Gene name
accD
Definition
(GenBank) acetylCoA carboxylase, carboxyltransferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00620  Pyruvate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDEF_0784 (accD)
   00640 Propanoate metabolism
    HDEF_0784 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0784 (accD)
Enzymes [BR:hde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     HDEF_0784 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HDEF_0784 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC Zn_Tnp_IS1595 Ogr_Delta Tmemb_55A
Motif
Other DBs
NCBI-ProteinID: ACQ67511
UniProt: C4K4L8
Position
779875..780777
Genome map
AA seq 300 aa AA seqDB search
MSWIERIYNKSHIIRTRKANIPEGVWTKCEKCEQILYSAELEQNLRVCPKCHHHMRISAR
ARLHAFLDEGFRIDLAEELAPKDLLKFKDTKKYKDRLSGAQKDTGEKDALIVIKGTLFGM
PLVSAAFEFSFMAGSMGSVVGARFVRAVEQALQDSCPFVCFSSSGGARMQEALTSLMQMA
KTSAALAKMQESGLPYISVLTNPTFGGVSASLGMLGDINIAEPKALIGFAGPRIIEQTVR
EKLPSSFQSSEFLIQKGAIDMIVSRLDMRHKLASLLSKLTHQPEPSMMPYKLQNMREDSH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgagcgaatttataataaaagtcatattatccgcactcggaaagccaat
atcccagagggcgtttggacgaaatgtgaaaaatgcgagcaaatattatatagcgcagaa
ttagagcagaatttaagggtttgtcccaaatgtcaccaccatatgaggatatcggctcga
gcgcggttacatgccttcttggatgaaggttttagaatcgacttggcggaagaattagca
cccaaagatctgttgaaatttaaagatacaaaaaaatataaagaccgcctttctggagca
caaaaagacactggtgaaaaagatgcgctgatagtcatcaaagggacgttgtttggtatg
cctcttgtgagcgctgcatttgaattttcttttatggcgggttctatgggatcggtcgtg
ggtgcccgttttgttcgtgccgtcgaacaagctttgcaagacagctgccccttcgtttgc
ttttcttcaagtgggggagccaggatgcaagaagcgctgacttccttgatgcaaatggca
aaaacaagcgcggcccttgctaaaatgcaggaatcgggattgccttatatttcggttctg
accaatcccacttttggcggtgtttctgctagtttggggatgctcggcgatattaatatt
gccgaacctaaagcgttaattggttttgcaggccctagaatcattgaacaaactgtcaga
gaaaaattaccctcaagctttcaaagcagcgaatttttaatccaaaaaggcgccatagac
atgattgttagccgtctcgatatgcgacacaagttagccagtcttttatctaaactgact
catcaacctgaaccttcgatgatgccatacaaattgcaaaacatgagagaagacagtcac
tga

DBGET integrated database retrieval system