KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0074Help
Entry
HDEF_0074         CDS       T00911                                 

Gene name
aroQ
Definition
(GenBank) 3-dehydroquinate dehydratase, class II
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Module
hde_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_0074 (aroQ)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     HDEF_0074 (aroQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-ProteinID: ACQ66849
UniProt: C4K8L2
Position
complement(74677..75174)
Genome map
AA seq 165 aa AA seqDB search
MRDFVCMPAQLNKYHILLLNGPNLNLLGLREPKQYGSLCLDKMIDLLEAKARTIGCQLSH
LQSNAEHALIEKIHASQDNVDFILINPAAFTHTSVALRDALLAVKIPFIEIHLSNVYARE
HFRHHSYFSDIAVGVICGLGVNGYDCALQAAVNHLSASFASINRV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttgtctgcatgccagctcaattgaataaatatcatatattgctattaaat
ggtccaaatctcaatttgttgggattacgcgaaccaaaacaatatggcagcctctgttta
gataaaatgatcgacctgctagaagcaaaagccaggacaatagggtgccaattatctcat
ttacaatccaatgcagagcatgcgttaatcgaaaaaattcatgcatctcaagataacgtt
gattttattctcatcaaccccgcagcattcacacataccagtgtggccttgcgcgatgcc
ttgctcgctgtcaaaattccatttattgagattcatctgtctaatgtgtacgcccgtgag
cattttcgccatcattcttatttttcggatattgcggttggtgtcatttgtggtctaggc
gtaaacggttatgattgtgcgttacaggcagcggtgaatcatttatctgcatcttttgcg
tccatcaacagagtataa

DBGET integrated database retrieval system