KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0075Help
Entry
HDEF_0075         CDS       T00911                                 

Gene name
aroH
Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (DAHP synthetase), tryptophan-repressible
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
hde02024  Quorum sensing
Module
hde_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_0075 (aroH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HDEF_0075 (aroH)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     HDEF_0075 (aroH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ACQ66850
UniProt: C4K8L3
Position
complement(75277..76338)
Genome map
AA seq 353 aa AA seqDB search
MLENHHLSIDRLRKQPINSLISQEELEKKLPISDAIASQVISGRRRIERILEGRDPRLLV
IIGPCSIHDSNAAIEYATRMKTLSEQYQNQLEIVMRTYFEKPRTAAGWKGMISDPLLDGS
SQVNLGIEMARKVLLDINRLGLPTATEFLDIIMGQYIADLISWGAIGARTTESQIHRQMA
SALSCPIGFKNGTDGNIDIAIDAVRVASASHIFVSPNKKGEMTIYQTLGNPYGHVVMRGG
KKPNYSAKDIALACHKLRDFHLPEHVVVDLSHGNCQKRYRHQLSVSHSMAEQIRSGSKAI
LGVMIESFLIEGSQQIVPEKPLIYGQSVTDSCLSWSNTEDLLYELSEAVKARF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgttagagaatcatcatctgtcaatagatagactaagaaaacagcctattaacagcctt
atttcacaggaagagttagaaaaaaaactacccatttcagatgcaatagcaagccaggtg
atcagcgggcgacgacgtatagaaagaattcttgaaggtagagatccccgtttattggtc
attataggcccctgctctattcacgattctaatgcggctattgaatacgcgacccgaatg
aagacattaagcgagcagtatcaaaatcaattagaaatagtcatgcggacctattttgaa
aagcctcgtactgcagcaggttggaaaggaatgatttctgatccattgctggatggctct
tctcaggtgaatctgggcattgaaatggccagaaaagtgcttttagatattaaccgtttg
ggtttacctaccgccactgaattcctggatatcatcatggggcagtatattgctgacttg
atcagttggggagccataggagcacgtacgactgaaagtcagatccatcggcagatggct
tctgctctatcttgccctatcggttttaaaaatggcactgatggcaatattgatattgct
attgacgctgttcgtgtggccagtgcaagccatatttttgtctctcctaataaaaaaggg
gagatgaccatttatcaaactttaggtaatccttatggccatgtcgtgatgagggggggt
aaaaaacccaattacagcgcaaaagatattgctctagcatgtcataagttacgtgacttt
catttaccagagcatgttgtcgtagatcttagccatgggaattgtcaaaaaagatatcgc
catcagttaagcgtttctcacagtatggctgagcaaattcgttctggttctaaagcaata
ttaggggttatgatagaaagctttttgatagaaggatctcaacaaatcgttcctgaaaaa
ccgttgatctacgggcaatccgtcacagattcttgcttaagctggtcaaatactgaagat
cttttatacgaattatcggaagcagtaaaggcgcgtttttaa

DBGET integrated database retrieval system