KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0092Help
Entry
HDEF_0092         CDS       T00911                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00780  Biotin metabolism
hde01100  Metabolic pathways
hde01212  Fatty acid metabolism
Module
hde_M00083  Fatty acid biosynthesis, elongation
hde_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0092 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HDEF_0092 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0092 (fabB)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     HDEF_0092 (fabB)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0092 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ACQ66867
UniProt: C4K8N0
Position
complement(95464..96681)
Genome map
AA seq 405 aa AA seqDB search
MKRAVVTGLGIISSIGNDKNEVLSSLYAGRSGITFSEEFKNSGMKSHVWGNVKLDTTGMI
DRKISRFMSDASIYAYLAMQQSIEDADLNNFDISSNERIGLVVGSGGGSPKNQVAGSDKM
RMNGLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCVGHALELIQLGK
QDIVFAGGAEELCWEMACEFDAMGALSTQYNATPEKASRAYDKNRDGFVIAGGGGMVVVE
ELEHALSRHAPIYGEIVGYGATSDGANMVAPSGEGAARCMKMAQKGLEVTIDYINVHGTS
TPLGDIKELEAIKSVFGHHSPFFSSTKSMTGHSLGAAGVHEIIYSLLMAKHNFIAPSINI
ETLVPEAVGMNVVTEMKELAINTVMSNSFGFGGTNATLIFSKYPR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtggttactggcttgggtattatttccagtataggtaacgataaaaat
gaggtcctgtcgtctttatacgctgggcgttctgggataactttctctgaagagtttaaa
aattcaggcatgaaaagccatgtctggggtaatgtgaaactcgataccacgggtatgatt
gatcgaaaaatttcccgttttatgagtgatgcttcaatttatgcttatctcgctatgcaa
caaagtattgaagatgccgatttaaataattttgatatttcctcaaacgagcggatagga
ttggtcgtcggttcagggggaggttcgcctaaaaatcaggtggcgggctccgataaaatg
cgcatgaatggtttaagaggagtgggcccttatatggtgaccaaagccatggcatccggt
gtttccgcatgtttggcgacgccttttaaaattaaaggagtaaattattcgattagctcg
gcctgtgctacgtctgctcattgtgtgggtcatgcattggaacttattcaattaggaaaa
caagacattgtttttgctggtggagcagaagaattatgttgggaaatggcctgtgaattt
gacgctatgggggcactttccactcaatataatgcaacaccagaaaaagcgtctcgagcg
tatgataaaaaccgggatggttttgtgattgcgggaggcggcggtatggtggtggtcgaa
gagcttgaacatgcgctctctcgccatgcgcctatttatggagagatagtgggttatggc
gccacgtcggatggcgctaacatggttgccccgtctggtgaaggcgccgctcgttgtatg
aaaatggctcagaaaggccttgaagtgaccatcgattatatcaatgtacatggtacctct
accccgcttggcgatatcaaagagctagaagcgattaaaagtgttttcggtcatcactct
ccgtttttttcatcgacaaaatcgatgacaggtcactccttgggagccgcaggggtgcat
gaaattatttacagtttactgatggcaaaacataattttattgcccccagcattaacatt
gagactcttgttccagaagcagtgggtatgaacgtcgtgactgaaatgaaagaattggca
atcaatacagtgatgtcgaatagttttggttttggaggcactaatgcgactttgattttt
tctaaatatccgcgataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0449Help
Entry
HDEF_0449         CDS       T00911                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00780  Biotin metabolism
hde01100  Metabolic pathways
hde01212  Fatty acid metabolism
Module
hde_M00083  Fatty acid biosynthesis, elongation
hde_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0449 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HDEF_0449 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0449 (fabF)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     HDEF_0449 (fabF)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0449 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ACQ67203
UniProt: C4K3R0
Position
452344..453585
Genome map
AA seq 413 aa AA seqDB search
MFKRRVVITGLGMLSPVGNTVESAWKAVLLGQSGIFLINHFDTSLYETRFAGLVKNFEAK
DYIPPKDIRRMDLFIQYGVAAGVQAMRDSGLDVTEQNQSRIGAAIGSGIGGLGLIEDNYS
LLVDKEAKKISPFFVPSTIVNMISGHLSIIYGLQGPNIAISTACTSGVHNIGHAARIIVY
GDADVMLAGGAEKSTTPLGVAGFAAARALSKRNHDPQAASRPWDKDRDGFVLGDGAGVLV
LEEYEHAKKRNAKIYAELVGFGMSSDAHHITNPLENGYGAALAMKNALKDAGVSASKINY
INAHGTSTIAGDKAEVEAIKTVFSEDAQNVMISSTKSMTGHLLGAAGAIESIFSILALHD
QVAPPTINLDNPDEGFDLDFVPNETRSLKNMEYTLCNSFGFGGTNGSVVFKKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaacgccgagtggtaatcactggacttggtatgttgtctcctgtcggtaacaca
gtagaatctgcatggaaagcagtccttttaggtcaaagtggcatctttttaataaatcat
tttgataccagcctctatgaaacgcgttttgctggcttagtcaaaaattttgaggctaaa
gattacattccacctaaagatattcgaagaatggatctttttatacaatatggtgtcgcg
gctggcgttcaagcaatgcgtgattctgggcttgacgtcaccgaacaaaatcaatcccgt
atcggcgcggctatcggctctggtattggtggattaggcctgattgaagataattattct
cttttagttgataaagaggctaaaaagataagcccgttttttgtgccttctactattgta
aatatgatatccggtcatcttagtattatttatggtctacaaggacctaacattgcaatt
tctacagcctgtacatccggtgttcataatattgggcatgccgctagaatcattgtttat
ggtgatgctgatgtcatgctggcaggaggcgcggaaaaaagcactacgccattgggtgtt
gcgggttttgctgctgctcgagctttatcaaaacgaaaccatgatcctcaggcagcaagt
cgtccttgggataaagatcgtgatggttttgttttgggtgatggcgcaggcgttcttgtt
ttagaagaatacgaacatgctaaaaaacgtaatgctaaaatttacgccgaactggtcggt
tttggtatgagcagtgatgctcatcatattaccaatccactagaaaatggttatggagca
gcattggcgatgaaaaatgcattaaaagatgcgggcgtgtcggcttcaaaaattaactat
attaatgcgcatggcacctctactattgcaggagacaaggcagaagttgaagctatcaaa
accgttttttctgaagatgcacaaaacgtgatgataagttcgaccaaatccatgacaggc
catttgttaggtgcggcaggtgcaatagaatctattttttcaattctagccttacatgat
caggttgccccccctactattaatttagacaatccagacgaaggctttgacttggatttt
gttcccaatgaaactcgttcattaaaaaatatggaatatactctttgtaattcctttggt
tttggtggcacaaacggctctgtagtgtttaaaaaaatatga

DBGET integrated database retrieval system