KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0096Help
Entry
HDEF_0096         CDS       T00911                                 

Definition
(GenBank) chorismate mutase type II
  KO
K04093  chorismate mutase [EC:5.4.99.5]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_0096
Enzymes [BR:hde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     HDEF_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2
Motif
Other DBs
NCBI-ProteinID: ACQ66871
UniProt: C4K8N4
Position
98695..99177
Genome map
AA seq 160 aa AA seqDB search
MSLIGINEIFLLINQRLYYMEDIAAYKAEKQLAIEDVEQEKRILRNAMLLAEQKGITPNS
IGPFFSALIHAAKLIQCRYQSDWQKKSITKKHPQNLAQMRYKLIQLNASLIERLYQALIA
GQKFDKTTSGSMIKMIHHPQLSETHKRKIVTALQAIHLSQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaattggaatcaatgaaatcttcttactgattaatcaacgtttgtattatatg
gaagatatcgctgcttacaaagctgaaaaacagttggcgattgaagatgttgagcaagaa
aaaagaattttgagaaatgccatgctactcgcagaacaaaaaggaatcacgccaaattcc
attggcccttttttttctgctttaatacatgccgcaaaattgattcaatgtcgttatcag
tcagattggcaaaaaaaatccatcactaaaaagcatcctcaaaatttagctcaaatgcgt
tataaactgattcagttaaatgcctctttaatagaacggttgtatcaggccctgattgca
ggtcaaaaatttgacaaaacgacttcgggcagcatgatcaaaatgattcatcaccctcaa
ctgagtgaaacgcataaaagaaagattgtgacagctttgcaggccatacacttgagtcaa
taa

DBGET integrated database retrieval system