KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0100Help
Entry
HDEF_0100         CDS       T00911                                 

Gene name
aspC_1
Definition
(GenBank) aspartate aminotransferase, PLP-dependent-1
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00220  Arginine biosynthesis
hde00250  Alanine, aspartate and glutamate metabolism
hde00270  Cysteine and methionine metabolism
hde00330  Arginine and proline metabolism
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01210  2-Oxocarboxylic acid metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDEF_0100 (aspC_1)
   00270 Cysteine and methionine metabolism
    HDEF_0100 (aspC_1)
   00220 Arginine biosynthesis
    HDEF_0100 (aspC_1)
   00330 Arginine and proline metabolism
    HDEF_0100 (aspC_1)
   00350 Tyrosine metabolism
    HDEF_0100 (aspC_1)
   00360 Phenylalanine metabolism
    HDEF_0100 (aspC_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_0100 (aspC_1)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    HDEF_0100 (aspC_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hde01007]
    HDEF_0100 (aspC_1)
Enzymes [BR:hde01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     HDEF_0100 (aspC_1)
Amino acid related enzymes [BR:hde01007]
 Aminotransferase (transaminase)
  Class I
   HDEF_0100 (aspC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACQ66875
UniProt: C4K8N8
Position
complement(100579..101769)
Genome map
AA seq 396 aa AA seqDB search
MFEKITNAPPDPILGLADSFNADPRDCKINLGIGIYMDETGNTPILNTVKKAEQHLLDHE
KTKNYLGIDGLKKFAACTQDLLFGRAHPILMDKRARTAQTPGGTGALRIAADFVTKKAGV
KRVWLSRPTWPNHNQIFSSVGLQIVDYDYYDAEHHRLNFTAMLNSLEKIQPGDLVLFHGC
CHNPTGIDPTKEQWEVLAEFIKKKGGLPIFDFAYQGFGRGLEEDAEGLRIFSQKHAEFMV
CSSYSKNFGLYNERVGACTIVAGDDKTAEAALSQLKTIIRATYSNPPAHGGAIVETILID
DILRNDWEKELTDMRQRIQRMRQLFVQTLKEKGANQDFSFIIDQKGMFSFSGLKTEQVLR
LREKFGVYAVNSGRVNVAAMTLNNMVPLCEAIAAVI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaaatcacaaacgctccgcccgatcctattttaggattggcagacagtttt
aatgcagaccctcgagattgtaaaattaatttaggcattgggatttatatggatgaaaca
gggaatacacccatattaaatacggtaaaaaaagcagaacaacatttacttgaccatgaa
aaaaccaaaaattatttagggattgatggattaaaaaaattcgcggcctgtacacaggat
ctcttattcggaagagctcaccctattttgatggataaaagagcccgtacggcacaaacc
cccggcggaacaggtgcccttcgtattgctgctgattttgtcaccaaaaaagcaggcgtc
aaacgagtttggctaagccgacccacctggccaaatcacaatcagattttctcttcggta
gggcttcaaatcgttgattatgattattatgatgcagaacatcaccgtttaaatttcaca
gcgatgttaaattctctagaaaaaatccagcctggagatttggtgttatttcatggatgc
tgtcataacccaacggggattgacccgacaaaagaacaatgggaagtactggcggaattc
ataaaaaagaaaggcggattacccatatttgattttgcctatcagggttttgggcgaggt
ttagaagaggatgcagaaggtctgaggattttttctcaaaagcatgctgaatttatggtt
tgtagctcttattcgaaaaattttgggctgtataacgagcgggttggcgcctgcaccatt
gtggcaggtgatgataaaaccgccgaggcagcattgagtcagctcaaaaccatcatacga
gccacctattcaaatccccccgctcatgggggcgcgatagtagaaacgattttaattgac
gatatattacgcaatgattgggaaaaagaattaacagatatgcgccagcgtattcagagg
atgcgtcaattatttgttcaaactttaaaagaaaaaggtgcgaatcaagattttagtttt
attatcgatcaaaaaggcatgttttcgtttagtggtttaaaaacggagcaggtgttacgt
ttgcgtgaaaaatttggggtatatgccgttaactctgggcgagtgaatgtggccgcgatg
acgctcaataatatggtgcctttatgtgaagccatcgcggcagttatttga

DBGET integrated database retrieval system