KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0105Help
Entry
HDEF_0105         CDS       T00911                                 

Gene name
ribB
Definition
(GenBank) 3,4 dihydroxy-2-butanone-4-phosphate synthase
  KO
K02858  3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00740  Riboflavin metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HDEF_0105 (ribB)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     HDEF_0105 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: ACQ66879
UniProt: C4K8P2
Position
complement(107334..107990)
Genome map
AA seq 218 aa AA seqDB search
MNQICLEYFGNSVARVKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIR
HGSGIVCLCLTEERCQQLELPMMVEKNSSTFQTPFTVSIEAAKGVTTGVSASDRITTIKA
AISQTAKPADLHRPGHVFPLKGHPKGVLGRSGHTEAAIDLARLAGLKPAGVLCELTNDNG
TMARAPEVIAFAKKHKMTVLSIEDLIEYRQTHMETNFS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatctgtcttgaatatttcggaaattctgtggcccgcgtcaaaaaggcactg
gagaatttaaaaaacggtcatggtgttatggtgctggatgatgaaaatcgcgaaaatgaa
ggcgattttgtgtttgcggcagaaaccatgacggtcgaacaaatggccctgacgattcgt
catggcagtggtattgtttgtctttgtttaactgaagaacgttgccaacagcttgaacta
ccgatgatggttgaaaaaaattccagtacttttcaaaccccttttacagtcagtattgaa
gcagcaaaaggggttaccacaggggtttcagcctcagatcggatcaccaccattaaagcg
gcgatatcacagacagcaaagcctgctgatcttcatcgtccaggccatgttttcccttta
aaagggcatcccaaaggcgttctgggtcgttctgggcatacagaagcggcgattgatctg
gcaaggttggcgggtttaaaacctgcgggggtgttatgtgaactcactaatgacaatggc
accatggcgcgtgcccctgaagtgattgcgtttgcaaaaaaacataaaatgacggtttta
agtattgaggatctgattgaatatcgtcaaactcatatggaaacaaatttttcatag

DBGET integrated database retrieval system