KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0118Help
Entry
HDEF_0118         CDS       T00911                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00740  Riboflavin metabolism
hde00790  Folate biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HDEF_0118 (ribA)
   00790 Folate biosynthesis
    HDEF_0118 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HDEF_0118 (ribA)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HDEF_0118 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACQ66891
UniProt: C4K8Q4
Position
120206..120796
Genome map
AA seq 196 aa AA seqDB search
MNLKRISEAKLPTPWGDFLMIGFKELDKEQDHLALVLGDISTDAPVLSRIHSECLTGDAL
FSLRCDCGFQLKAAFKQICEEKRGLLIYHRQEGRNIGLLNKIRAYALQDQGADTVEANHQ
LGFATDERDFTVCANIYKILDVKAIRLLTNNPEKIKILKKEGINVVQRVSLIVESNPNNQ
DYLSTKKNKMGHFFKK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgaaacgtatatcggaagcaaaattaccgaccccttggggtgattttttaatg
atcggatttaaagaattagacaaggaacaagatcatcttgcattagttttaggtgatatt
tcaacggatgcccccgtattatccaggatccactctgaatgtttaacaggagacgccttg
tttagcttacgttgtgactgtggttttcaactgaaagccgcatttaagcagatttgtgaa
gaaaaacgaggtctactcatttatcatcgtcaagagggaagaaatatcggactgttaaat
aaaattcgagcttatgcacttcaagatcaaggagctgatacggttgaagcaaaccatcaa
cttggttttgccaccgatgaacgtgattttaccgtctgtgccaacatttataaaattctg
gatgtcaaagcgatacgtttgctgaccaataatcctgaaaaaatcaagattttgaaaaaa
gaaggcatcaatgttgttcagcgagtgtcgttaatcgtagagagtaatccaaacaatcaa
gactatttatcaacaaaaaagaataaaatggggcatttttttaaaaaataa

DBGET integrated database retrieval system