KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0152Help
Entry
HDEF_0152         CDS       T00911                                 

Gene name
dapD
Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00300  Lysine biosynthesis
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HDEF_0152 (dapD)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     HDEF_0152 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THDPS_N_2 Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ACQ66925
UniProt: C4K8T8
Position
156713..157558
Genome map
AA seq 281 aa AA seqDB search
MSDAQKMIENAYENRASITAKNVAPSLRKTIDEIIEQLDRGERRVAEKINGHWVTHEWLK
KTILLFFCIHDNQMIKGLETAYYDKIPLKFSDYQSDRFLRERLRVVPQATVRKGAFIAKN
TVLMPSYVNVGAFVDEGTMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQTNPTIIED
NCFIGARSEIVEGVVVEEGAVISMGVFISQSTRIYDRETQTMHYGRVPAGAVVVPGSLPA
KDGSHSLYAAIIVKKVDAKTKEKISMNELLRYDECLQKESF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgcacaaaagatgattgagaatgcctatgaaaatcgcgccagtatcacggca
aaaaatgtagctccctcgctgaggaagaccattgatgagattattgagcaattagacagg
ggcgaacgaagagttgccgaaaaaataaatgggcattgggtaacacatgaatggctaaaa
aaaacaatcctgctctttttctgtattcatgataaccagatgataaaaggcttggaaaca
gcgtattacgataaaatacctttgaaattttctgattatcaaagcgacagatttttacgt
gaacgcttacgtgtggttccccaggcaaccgtacgaaaaggcgcatttatcgcgaaaaat
acggttctcatgccctcttatgttaacgtcggcgcttttgttgatgagggtacgatgatc
gatacttgggccacagtgggttcttgcgcccaaattggtaaaaacgttcacctatcaggc
ggtgtgggtattggaggtgttttggaacctctacaaaccaatccgactattatcgaagac
aactgttttattggtgctcgttcagaaatcgttgaaggcgtggtggtggaagaaggcgct
gtgatttctatgggcgtgtttatcagccaaagtacccgcatttatgatcgtgaaacccaa
acgatgcattatggtcgtgttcctgccggtgccgtcgttgttccaggcagcctccctgct
aaagatggaagccacagcctgtatgctgcgatcattgtgaaaaaagtagatgccaaaaca
aaagaaaaaatctctatgaatgaattgctgcgttacgatgaatgcctacaaaaggaatca
ttttga

DBGET integrated database retrieval system