KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0157Help
Entry
HDEF_0157         CDS       T00911                                 

Gene name
manZ
Definition
(GenBank) PTS family enzyme IID, mannose-specific
  KO
K02796  PTS system, mannose-specific IID component
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde02060  Phosphotransferase system (PTS)
Module
hde_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_0157 (manZ)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0157 (manZ)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_0157 (manZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_0157 (manZ)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    HDEF_0157 (manZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIID-AGA
Motif
Other DBs
NCBI-ProteinID: ACQ66930
UniProt: C4K8U3
Position
complement(162190..163083)
Genome map
AA seq 297 aa AA seqDB search
MIDTTETSQKETQTIADENVASSKKKLTAGDMRSAFIRSNLFQGSWNFERMQALGFCFSM
IPAIRRLYPENNAERQQAIKRHLEFFNTHPYVMAPVIGVTMAMEEKRANGAPIDDAAING
IKVGLMGPLAGVGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLLSLYYGI
AYGYSKGMSMVSDMKGGVLQKLTEGASILGLFVMGALVNKWTHINIPVVVSTITDQTGHT
TVTTLQTIFDQLMPGLVPLLLTFACMWMLRRNVNALWIILGFFAIGIFGYWLGFLAP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgattgatacgactgaaacatctcaaaaagaaacccaaacaatcgcagatgaaaatgtg
gcatccagtaaaaaaaaattaacggcaggtgatatgcgttcggcatttatccgttctaat
ctttttcaaggttcctggaattttgaacgtatgcaggcattaggattttgtttttcgatg
atccctgcgatccgccgtttgtatccagaaaataatgctgaacgtcaacaagcaatcaaa
cgccatttagaattttttaatactcatccttacgttatggcgcctgtcataggtgtcacg
atggcaatggaagaaaaacgagccaatggtgcacccattgatgatgcagccattaacgga
attaaagtcggtttaatgggtcctcttgccggcgtgggtgatccgattttttggggaacg
gtacgtcctgtttttgctgctcttggagcagggattgccatgagtggaagcctactggga
cctttattgttttttatattatttaaccttgtgcgtttattatctctctattacggcata
gcttatggttactcaaaaggcatgagtatggtgagtgacatgaagggaggggtcttgcaa
aaattaacagaaggcgcttctattcttgggttatttgtgatgggtgccctagtgaataaa
tggacacatattaatatccctgtcgttgtctctacaatcacagatcaaacaggtcatacc
actgtcacgacgttacaaactatttttgatcaactgatgcctggtttagtgccattacta
ttgacctttgcatgtatgtggatgttacggcgaaatgttaatgccctatggattattcta
ggtttctttgccatcggcatctttggttattggctcggctttcttgctccttaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0158Help
Entry
HDEF_0158         CDS       T00911                                 

Gene name
manY
Definition
(GenBank) PTS family enzyme IIC, mannose-specific
  KO
K02795  PTS system, mannose-specific IIC component
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde02060  Phosphotransferase system (PTS)
Module
hde_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_0158 (manY)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0158 (manY)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_0158 (manY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_0158 (manY)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    HDEF_0158 (manY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: ACQ66931
UniProt: C4K8U4
Position
complement(163098..163901)
Genome map
AA seq 267 aa AA seqDB search
MEITTLQILLIFFIACIAGMDSVLDEFQFHRPLVACTLIGLVLGDLKTGIIIGGTLEMIA
LGWMNIGAAMAPDTALASIISSILVIAGGQSIGAGIALAIPLAAAGQVLTIIVRSITVAF
QHAADRAAEQGNLRGISFLHISALFLQAMRVAVPVLVVALSVGTSEVRALLSSIPEVVTG
GLNIAGGIIVVVGYAMVINMMGARYLMPFFYLGFVTAAFIQFNLVALGVIGIVMAILYIQ
LNPKYHKSASEPSDANKLYNDLDNELD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggagataacgactcttcaaattttactcatattttttattgcatgcattgctggcatg
gactctgttttagatgaatttcaatttcatcgtccattggttgcctgtactttgattggc
ttggttttgggggatctcaaaacagggatcatcataggggggacccttgaaatgattgcc
ctaggctggatgaatattggtgctgcgatggctcccgatacggctttggcttctattatt
tccagtattttagtaatagcgggaggacaaagtatcggcgcagggattgcgttagcaata
cctctggcagcggcagggcaggttttaacgatcattgttcgtagcatcactgttgctttt
caacatgctgctgacagagctgcggagcaaggcaatctcagaggcatcagcttcttgcac
atttccgctttatttttgcaagcgatgcgtgttgctgtgcctgtcctggttgttgcttta
tcagttggaaccagcgaagtacgagccttactgagttctattcctgaagtagtcacagga
ggattaaatattgcaggaggtattatcgtggtagtcggctatgccatggtcatcaatatg
atgggagctcgatacctgatgccatttttttatttaggatttgtcactgccgcattcatt
cagttcaaccttgtcgctttgggtgtcatcggaatagtcatggcgattttgtatatccaa
ttaaatccgaaatatcataaatcagcgtctgagccatctgatgcaaacaaactttataat
gatcttgataacgaattagattaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0159Help
Entry
HDEF_0159         CDS       T00911                                 

Gene name
manX
Definition
(GenBank) PTS family enzyme IIA (N-terminal); enzyme IIB (C-terminal), mannose-specific
  KO
K02793  PTS system, mannose-specific IIA component [EC:2.7.1.191]
K02794  PTS system, mannose-specific IIB component [EC:2.7.1.191]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde02060  Phosphotransferase system (PTS)
Module
hde_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_0159 (manX)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0159 (manX)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_0159 (manX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_0159 (manX)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.191  protein-Npi-phosphohistidine---D-mannose phosphotransferase
     HDEF_0159 (manX)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    HDEF_0159 (manX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb EIIA-man TraE
Motif
Other DBs
NCBI-ProteinID: ACQ66932
UniProt: C4K8U5
Position
complement(163953..164963)
Genome map
AA seq 336 aa AA seqDB search
MNIAIIIGTHGNCAKYLLETAEMLIGQQKNVAYVDFLPGENTETLVHKYHEILATLQAQD
GVLFLLDTWGGSPFNAANRIIADKENYEAISGVNVPMLIEVLMARDDDISLSQLVSIALE
TGSAGIKASKMSNEPALKKSNLPSLNIHPESERFNLASVNDPQNQGHMKIQLVRIDDRLI
HGQVATRWTKETNVNRIIVVSDEVAADQMRISLLKQVAPPGVSGHVININKAIRVYHNPK
YANDRVMLLFTHPSDVLRLIEGGVKISSVNVGGMAYTQGKIKINNAISVFEKDIDAFTTL
SQLGIKLDVRQVPSDISSNIMDLISKIKNKKLIYSE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattgctattatcattggcacacatggaaattgtgcaaaataccttttagaaaca
gcagaaatgctgataggtcaacaaaaaaacgtggcttatgttgactttttgccaggggaa
aacacggaaacattagtacataaatatcatgaaatattagcaactttgcaggcccaggat
ggggtgttgtttttattggatacttggggtggaagcccttttaatgcagcaaatagaata
attgctgataaagaaaattatgaagcgatttctggtgttaacgtgccgatgctgattgaa
gttttgatggcgcgagatgatgacatttctttatctcaattagtttctatcgcattggaa
acagggagtgctggaatcaaagcgtctaaaatgagtaacgaacctgctctgaaaaaatcg
aatctcccttctttgaatattcatcccgaatctgaacgcttcaatttagcatctgtaaat
gatccacagaatcagggccacatgaagattcaattagttcgtattgatgatcgtttaatt
catgggcaagtagccactcgatggaccaaagaaaccaatgtaaatcgcattatcgtggtc
agtgatgaagtcgcagcagatcaaatgcgaatcagtttattaaaacaggttgcgccgcct
ggcgtcagtggtcatgttatcaatattaacaaggcgattcgtgtttatcacaatcctaaa
tatgcaaatgatcgagtcatgctgctatttactcatccttctgatgtactacggttgatt
gaagggggagtgaagatttcgtcagtgaatgtagggggtatggcttatactcaaggtaaa
atcaaaataaacaatgctatctcggttttcgagaaagatattgatgcatttacgacatta
tctcaactaggaataaaactggatgttcgtcaagttccttcagatatctcctctaatatc
atggatttaatcagtaagataaaaaataaaaaattaatttattcagaataa

DBGET integrated database retrieval system