KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0160Help
Entry
HDEF_0160         CDS       T00911                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00630  Glyoxylate and dicarboxylate metabolism
hde00670  One carbon pool by folate
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HDEF_0160 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_0160 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_0160 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    HDEF_0160 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HDEF_0160 (glyA)
Enzymes [BR:hde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     HDEF_0160 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 OKR_DC_1 Beta_elim_lyase DegT_DnrJ_EryC1 Pex14_N
Motif
Other DBs
NCBI-ProteinID: ACQ66933
UniProt: C4K8U6
Position
complement(165339..166580)
Genome map
AA seq 413 aa AA seqDB search
MSKNIAEYDADLWRAMKQEIIRQEEHIELIASENYTSHLVMEAQGSQLTNKYAEGYPRKR
YYGGCENVDIVEELAIERAKKLFDADYANVQPHSGSQANTAVYMALLNPGDTVLGMDLNH
GGHLTHGSAANFSGKLYNIIPYGVDQKGKIDYSTLEKLATHHKPKMIIGGFSAYSGIVDW
RKMRTIADSVGAYLLVDMAHVAGLVATGVYPTPLPHAHVVTTTTHKTLAGPRGGLILAKG
GNESLYKKLNSAIFPGIQGGPLMHVIAAKAVAFKEALEPQFKIYQQQVVKNAKAMVDIFL
KRGYEIVSGGTENHLFLLNLVDKGLTGKEVDELLGRANITVNKNTVPNDPKSPFITSGIR
IGTPAITKRGFKEEEAREVSAWICDLLDHTQDEKLIHNVKEKVLSICARFPVY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatattgcagagtatgatgctgatctatggcgcgccatgaagcaggaaata
atacgtcaagaagaacacattgaattaatcgcgtctgaaaactacacaagtcatcttgtg
atggaggctcaaggttcacagctgactaataaatatgcggagggatatccgagaaaacgc
tattacggtggatgtgaaaatgttgatatcgttgaagaactcgcaatagaacgagcaaaa
aaattatttgatgctgattacgcaaatgtgcaaccgcattcaggctcacaagcgaatact
gctgtttatatggcattactcaatcctggcgatacggtattagggatggatttaaatcat
ggcggccatttaacacatggatctgcagccaatttttcaggaaagctgtataatattatt
ccttatggtgttgatcaaaaaggaaaaattgactatagcactttagaaaaattggcaaca
catcacaaacccaaaatgattattggaggattttctgcttattcaggtatcgttgattgg
agaaaaatgcgcactattgcagatagcgtcggggcttatttattggttgatatggctcat
gtagcaggtttagtggcaacgggcgtttacccaacgccgctgcctcatgcgcatgtggtc
actaccaccactcacaaaaccttggctggccctcggggtggtttaattcttgcaaaaggg
ggcaatgaatcattatataaaaaactcaattcggcgattttcccaggaattcaagggggg
ccattaatgcacgtgattgcagcaaaagccgtagcattcaaagaagccttggaacctcaa
tttaaaatttatcagcagcaagtggtaaaaaatgccaaagcgatggtcgacatattttta
aagcggggttatgaaattgtttcaggtggaacagaaaatcacttatttttactgaattta
gtagataaaggcttaactggaaaggaggtagatgaattgctgggccgtgctaacattaca
gtgaataaaaatacggtgcccaatgatcccaaaagtccttttatcacatcgggtatacgg
attgggactccagcaattacaaaacgagggtttaaagaggaagaagcacgtgaagtatca
gcttggatatgtgatttattagatcatactcaagatgaaaaattgatacataatgttaag
gaaaaagtgctgtctatttgcgcgcgctttcctgtttattga

DBGET integrated database retrieval system