KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0176Help
Entry
HDEF_0176         CDS       T00911                                 

Gene name
cpsG
Definition
(GenBank) phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_0176 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0176 (cpsG)
Enzymes [BR:hde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     HDEF_0176 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACQ66949
UniProt: C4K8W2
Position
complement(179871..181247)
Genome map
AA seq 458 aa AA seqDB search
MPKLSCFKAYDIRGRLGEELNEEIAYRVGRAYAELTKAKTVVVGGDVRLSSESLKCALSR
GLQAGGVDVLDIGVSGTEEIYFATFHLGLDGGIEVTASHNPIDYNGMKLVQKGARPISGD
TGLKEIQKLAELNAFSPLEHRSTGCYKKISTMTAYIDHLMSYITPAHFTMPLKLVVNSGN
GAAGPVIDMLENRFNTLKMSLTLVKMHHQSDGTFPNGIPNPLLPERRQATSDAVLAEGAD
MGIAFDGDFDRCFFFDHRGQFIEGYYMVGLLAEAFLQKEQGARIIHDPRLSWNTIDTVKA
YGGKAVMSRTGHAFLKERMRSEDAIYGGEMSAHHYFRDFAYSDSGMIPWLLIAELLCVKG
QKLQQLVEERMAAYPVSGEINCQLANPTQAIERVRAAYQPNALSVDETDGISMEFKDWRF
NLRSSNTEPVVRLNVESRANKALLDEKTAEILTLLNAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattatcctgttttaaagcttatgatatccgtgggcgcttaggtgaagaactc
aatgaagaaatcgcctatcgcgttggtcgagcttatgcggaattgactaaagccaaaacc
gtcgtcgtgggtggtgatgtgcgtttaagcagcgaaagcctcaagtgcgccctctctcgc
ggtttacaagcaggcggtgtagatgtgttggatatcggtgtctcaggtacagaagaaatc
tattttgctacctttcatcttggtttggacgggggtattgaagtcactgccagccacaat
cccatcgattataatgggatgaaactcgtgcaaaaaggggctcgtcctatcagtggcgat
acagggctcaaagagatccaaaaactagctgaattaaatgcattctcccctctagaacac
cgttcgacaggctgttataaaaaaatctcgaccatgacagcctatatcgatcatttgatg
agttatatcacgcctgcccatttcactatgcctttaaagttagtggtgaacagtggcaat
ggcgccgcaggccctgtgattgatatgctagaaaatcgattcaatacgctcaaaatgtct
ttgacactggtcaaaatgcatcatcagtcggatggcacttttcctaacgggatcccaaac
ccgcttttgccagaacgccgccaggcgacttccgatgcggtgttggcagaaggtgctgat
atgggcatcgcctttgatggtgatttcgatcgctgttttttctttgatcatcgaggccaa
tttattgaaggctattatatggtcggcttgttggcagaagcttttttacaaaaagaacag
ggcgcccggattattcatgatccccgtttaagctggaacaccatcgatacagtgaaggcg
tatgggggtaaagcggttatgtcgagaacaggccatgcgtttcttaaagagcgtatgcgt
tcagaagatgccatttatggcggtgagatgagtgcccatcattattttcgcgattttgct
tactctgactctgggatgatcccttggctgttgattgccgagctcctgtgtgtcaaaggc
caaaaactacaacaattggtggaagaacgcatggcggcttatcctgtgtctggtgaaatt
aattgccagttggcgaatccgactcaggcgattgagcgtgttcgggccgcatatcaacca
aatgcgttgtctgtagatgaaacggatggtatcagtatggaatttaaagattggcgtttt
aatcttcgctcttcgaatacggaacctgtggttcggcttaatgtagaatcacgtgccaat
aaagcgctgttagacgaaaaaaccgctgaaatattaacgttattaaatgctcgataa

DBGET integrated database retrieval system