KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0190Help
Entry
HDEF_0190         CDS       T00911                                 

Gene name
galE_2
Definition
(GenBank) UDP-galactose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00052  Galactose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HDEF_0190 (galE_2)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0190 (galE_2)
Enzymes [BR:hde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     HDEF_0190 (galE_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD KR RmlD_sub_bind NAD_binding_4 adh_short NAD_binding_10 NmrA PAX MOZART1 Methyltransf_28
Motif
Other DBs
NCBI-ProteinID: ACQ66959
UniProt: C4K316
Position
complement(193809..194855)
Genome map
AA seq 348 aa AA seqDB search
MNNVKVLVTGGLGYIGSHTCVQMIEQGVQPVILDNLCNANPEVLNRIETITGTRPTFYEG
DVRDKSIIDAIFTQHNITSVLHFAGLKAVGESVQKPIEYYDNNVYGTLVLVQCMQKAGVK
SLIFSSSATVYGDPEKVPLTEQSKVGATTNPYGTSKYMVERVLTDLHITHDECSITLLRY
FNPVGAHQSGLIGEDFQGIPNNLMPYIAQVAVGRYKEVMVFGVDYPTLDGTGVRDYIHVM
DLADAHITALNHVSQKPGLHIYNLGTGKGTSVLEMIAAFEQVVGKTIQYKIVGRRSGDIA
ECWSSPAKAFQDLGWKAKYSLQEMVDDSWRWQSQNPNGYSTVENINLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgtaaaagtattggtcacgggtggcctcggctatattggtagccacacatgt
gtacagatgattgagcaaggtgtccaacctgttattttagataatttatgtaatgccaac
cctgaggtattaaaccgtattgaaacgattacgggaacaagaccgactttctatgaaggt
gatgtgcgtgataaatcgatcattgatgcgatttttactcagcacaacataacttccgtg
ctccattttgcagggcttaaagcggttggtgaatcagtacaaaaaccaattgagtactat
gacaataatgtttatgggacattggtgttggttcaatgtatgcaaaaagctggcgtaaaa
agccttatttttagctcttctgcgacagtgtatggtgacccagaaaaagttccgcttact
gaacaatctaaagtaggtgcaaccacgaacccatatggcaccagtaaatatatggtagag
cgtgttttaaccgatttacatattactcacgacgaatgttcaattacactactgcgctat
tttaaccctgttggtgctcatcaatcagggttaatcggtgaagattttcaaggtatccct
aacaatctcatgccatatattgcacaggttgccgttggtcgatacaaagaagtcatggtg
tttggtgtcgattacccaacgcttgatggtactggtgtgcgtgactatattcatgtgatg
gatttagcagatgctcatatcacggcactgaaccatgtaagccaaaaaccaggcttacat
atttataacttaggcactggtaaaggcactagcgtgttagaaatgattgctgcttttgaa
caagtggtaggtaaaactatccaatacaaaattgttggacgccgctctggtgatattgcg
gaatgttggtctagccctgcaaaagcttttcaggatttaggctggaaagcaaagtattct
ctacaagagatggttgatgatagctggcgttggcaatcacagaatcctaacggttatagt
actgttgaaaacattaacttactttaa

DBGET integrated database retrieval system