KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0221Help
Entry
HDEF_0221         CDS       T00911                                 

Gene name
pepA
Definition
(GenBank) aminopeptidase A, a cyteinylglycinase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_0221 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hde01002]
    HDEF_0221 (pepA)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     HDEF_0221 (pepA)
Peptidases [BR:hde01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   HDEF_0221 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ACQ66989
UniProt: C4K346
Position
complement(228903..230408)
Genome map
AA seq 501 aa AA seqDB search
MEFKVNSECSEKQSSDCIVIGIFESGEFSPSAEKVNKISHGYLKGLPQNADLQGKAEQAL
LLHHVPHVAAERVLLIGCGKEEELDERRYKKLIKKMVNTLKETGAKNVFCYLPELKVKGK
DIDWKIRSAIEVIQDALYCFDHYKSTKTLHALNQITFIVTATQTKAAQTAIQEGIALAVG
INEAKNLANTPPNICNPAYLNASARKWAEKFKNVRVSVVNEDEMKKLGMNAYLAVGQGSK
NESLMSIIEYKSGKIPAGTKPIVLVGKGMTFDSGGISIKPSQNMDEMKYDMCGAATVFGV
MNVVAELNLPLYVIGVLAGAENMPGGNAYRPGDILTTLSGQTVEVLNTDAEGRLVLCDAL
TYVERFDPELVIDIATLTGACVVALGHHMSGLMSNHAPLAEDLLHASEQSGDLAWRLPLG
EEYQEQLDSNFADMANIGGRTAGAITAGCFLSRFTHQYHWAHLDIAGTAWRTGKEKGATG
RPVALLSQFLLNKALAQKQGA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaaagtcaacagtgaatgttcagaaaaacaatcatctgattgtatcgtcatc
ggcatttttgaatccggggagttttctccctctgcagaaaaggtgaataaaatcagccat
ggctatcttaaaggtttgccacaaaatgcagatttacaggggaaagcagaacaagcgtta
ttattgcatcatgttcctcatgtcgcagcagagcgtgttcttttaatcggttgtggtaaa
gaagaagaactcgacgaacgccgttataaaaagttgataaaaaaaatggtcaatacgtta
aaagagacaggggctaaaaatgtgttctgttatctgccagaattaaaagtaaaagggaaa
gacattgattggaaaattcgctctgccatagaagtcattcaagatgccctttactgtttc
gatcattataaaagtacaaaaacacttcatgcgttaaatcaaatcacattcattgtcaca
gccactcaaaccaaagccgctcaaacggccattcaagaaggtattgcgttggccgtcggt
atcaacgaagccaaaaatctggccaatacgccgcctaatatttgcaatccagcctattta
aatgcttcggcgaggaaatgggcggaaaaattcaaaaacgtccgtgtttctgtggtgaat
gaagatgaaatgaaaaagctggggatgaatgcttatcttgccgtgggccaaggttcaaaa
aacgagtctttgatgtccatcattgaatataaaagcggcaaaattcctgctggcacgaaa
cctatcgtgctggtggggaaaggcatgacgtttgattcaggcggaatttcaatcaagccc
tcccagaacatggatgaaatgaaatacgacatgtgtggcgcagccactgtgttcggggtg
atgaatgtcgtggctgaactgaatttgcctctttatgtgataggtgttttggcaggggct
gaaaacatgccagggggaaatgcctatcgcccaggagatatattaaccaccctgtcaggc
caaaccgttgaagtgctcaatactgatgcagaaggccgcctggtgttgtgtgatgcctta
acctatgtggaacgttttgatccagaactggtgattgacattgcgaccttaaccggagcc
tgtgtggtggccttagggcatcatatgagcggtttgatgtctaaccatgcgcccttggct
gaggatctgctgcacgcgtctgaacaatccggcgatctggcgtggcgcttacctttaggt
gaagaatatcaagagcagctcgattccaactttgcagatatggctaatatcgggggtcga
actgccggcgccattactgccggttgcttcttgtctcgttttactcatcaataccattgg
gcccatcttgatatcgcaggcaccgcctggcgtacaggtaaagaaaagggggcaacgggt
cgccctgtggctttattgtctcaatttttattaaataaagctttggctcaaaaacaagga
gcttaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0876Help
Entry
HDEF_0876         CDS       T00911                                 

Gene name
pepN
Definition
(GenBank) aminopeptidase N, a cysteinylglycinase
  KO
K01256  aminopeptidase N [EC:3.4.11.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_0876 (pepN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hde01002]
    HDEF_0876 (pepN)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     HDEF_0876 (pepN)
Peptidases [BR:hde01002]
 Metallo Peptidases
  Family M1
   HDEF_0876 (pepN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3458_C Peptidase_M1 DUF3458 Peptidase_M1_N Peptidase_M61 DUF2268
Motif
Other DBs
NCBI-ProteinID: ACQ67595
UniProt: C4K4V2
Position
complement(896606..899221)
Genome map
AA seq 871 aa AA seqDB search
MTNQPQIKYRQDYRPPSHLISDIHLDFNLNEKKTRVTATSQIQRQTSEDTPLILNGENLI
LISVSVNDQIWPHYSQKDDHLIIEQLPKAFSLTIVNEIHPDKNTALEGLYLSGQTLCTQC
ESKGFRHITFFLDRPDVLARFTTRILADKKRYPYLLSNGNKIRQGELKDGRHWVEWADPF
PKPSYLFALVAGDFDVLRDQFTTQSGRSVELALFVDKGHLDRADWAMSALKKAMKWDENR
FGLEYDLDIYMIVAVDFFNMGAMENKGLNVFNSKYVLAKTETATDKDYLHIEAVIAHEYF
HNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDSGCRAVRRIENVRLMRSAQFAEDASPM
AHPIRPDKVMEMNNFYTLTVYEKGAEVIRMLHTLLGESVFQAGMKRYISRHDGCAVTCDD
FVQAMEDASGLDLTLFRRWYSQSGTPELIIRDHYDAQKQQYHLQVSQITPPTADQEKKYP
LHIPLDIELYTKKGEVIPLQNQGQPIDSVLNVIKAEQTFIFDSVSSEPVPSLLREFSAPV
KLDYPYTDQQLICLMQNARNDFSRWDASQRLLNSYIKKNIAEFHENEPLTLPLHLIEVFR
HVLLNDNLSPALIAEILTIPSENEIAELSCFIDPDAIHFVRQKWLRFFSASLSETLWDQY
QKHQTPIYRVTHTDTAKRALKNICLQYLAFGRTDIADQRVKTQYQTSSNMTDTFAALTAA
VAAQLPCRDFLLSDFESRWHSDPLVMDKWFFLQATRPEKEVVDKVRALLTHPSFSLMNPN
RVRALLGAFASSNPVVFHAKDGAGYTLFLEILTTLNTQNPQVAARLIEPLIRFKRYDSVR
QKWMKQVLEKLKALNNLSKDLNEKILKALED
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccagcctcaaataaaataccgacaggattatcgtcctcccagtcatcttatt
tctgatattcaccttgattttaatctcaatgaaaaaaaaacgagggtgacagccaccagc
cagatacagcgccaaacatcggaagacacgcctttaatcctcaatggtgaaaacctcatt
ttaatcagcgtgagcgttaatgaccagatctggcctcattattcccaaaaagacgatcac
ctcatcattgagcaattaccgaaggcttttagcctgacgatcgttaatgaaattcatcca
gataaaaacacggctttagaaggattatacctctccgggcagactttatgtacgcaatgt
gaatccaaagggtttcgacatattaccttctttttagataggcccgatgtattagcgcgt
tttacaacgcgaattctggccgataaaaaacgttacccctatttgctgtctaatggaaat
aaaatcaggcaaggagaactcaaagatggtcgtcattgggttgaatgggcagatcccttt
ccaaagccctcttatctatttgcgctggtggccggtgattttgatgttttaagagatcag
tttaccactcaatcaggccgctctgttgaattagcactctttgttgacaaagggcattta
gatcgcgctgactgggcgatgagtgcactcaaaaaagccatgaaatgggatgaaaaccgc
tttggtctggaatacgatctcgatatttatatgattgtcgccgtcgatttctttaatatg
ggtgctatggaaaacaagggattgaatgtttttaattctaaatatgtgctcgccaaaaca
gaaaccgccaccgataaagattatcttcatattgaagccgtaatagcccatgaatatttt
cataactggaccggcaatcgagtgacttgtcgagactggtttcaacttagccttaaagaa
ggcctcactgtatttcgtgatcaggaatttagctcagattcaggatgcagagccgttcgc
cgcattgaaaatgtgcgcctgatgcgctcggcacaatttgctgaagatgccagccctatg
gcgcatcccattcgccccgataaagtcatggaaatgaataatttttacaccttaaccgtg
tatgaaaaaggggcagaggtgatccgcatgctgcacaccttgttgggtgaatctgtgttt
caggcgggcatgaagcgttacatcagccgccatgatggttgcgcggtcacctgtgatgat
tttgttcaagcgatggaagacgcctcagggttagacctgaccttatttcggcgttggtac
agccaatcagggacacccgaattgatcattcgcgatcattatgatgctcaaaaacagcaa
tatcatttgcaagtctctcaaatcacgccgcccacggccgatcaagaaaaaaaatatccg
ctgcatattccgcttgatattgaattgtacacaaagaaaggtgaagtcattcctttgcaa
aaccaggggcagcccatcgactctgttctgaatgtgataaaagcagaacagacctttatt
tttgattctgtgtcttctgagcctgttccttctctgttgcgtgaattttcagctccagtc
aagctcgattacccttataccgatcaacagctgatatgtttaatgcagaatgctcgtaat
gatttttctcgttgggatgcgagtcaacgtcttttgaatagttatatcaaaaaaaatatc
gctgaatttcatgaaaacgagcctttaactttaccattgcatttgatagaagtgtttcga
catgttttactcaatgataatctctctcctgcattaatcgctgaaatattgacgatccct
tcagaaaatgaaattgctgagctttcctgtttcattgatcctgatgccattcattttgtt
cgccaaaaatggcttcgctttttttcagcgtctttatcagagacactttgggatcaatat
caaaagcatcaaacccccatttatcgtgtcactcataccgataccgcaaagcgggctctc
aaaaatatctgcctgcaatatcttgcgtttgggcgaaccgatatcgccgatcagcgggtg
aaaacccaatatcaaacatccagcaatatgacggacacctttgcggctttaacagcggcg
gtcgcagcccaattaccctgtcgtgattttttattatcggattttgaaagccgttggcat
tcagatccgctggtcatggataaatggtttttcttgcaagccactcgccctgaaaaggaa
gtcgtcgataaagtccgcgcgttattaacacatccttcgtttagtttgatgaatcctaac
cgggtgcgcgctttattaggggcttttgcttcgtctaatcctgttgtattccatgccaaa
gacggcgcaggttacacgctttttcttgaaattttgacaacgctcaatactcaaaaccct
caagttgcggcacgcttgatagaaccccttattcgttttaagcgttatgattcagttcgc
caaaaatggatgaaacaggtactggaaaaactcaaggccttgaacaatttatcgaaggat
ctgaatgaaaaaattctcaaagcgttagaggattaa

DBGET integrated database retrieval system