KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0267Help
Entry
HDEF_0267         CDS       T00911                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00260  Glycine, serine and threonine metabolism
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0267 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_0267 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_0267 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hde04131]
    HDEF_0267 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0267 (gpmA)
Enzymes [BR:hde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HDEF_0267 (gpmA)
Membrane trafficking [BR:hde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HDEF_0267 (gpmA)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HDEF_0267 (gpmA)
  Exosomal proteins of melanoma cells
   HDEF_0267 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACQ67032
UniProt: C4K389
Position
complement(265808..266557)
Genome map
AA seq 249 aa AA seqDB search
MTIKKLILVRHGESEWNKENRFTGWADVDLSEKGRVEAQQAGNLLKKKGFSFDFAYTSVL
RRATNTLSLILDVLQQQNLPIEKSWRLNERHYGALQGLNKSETAAKFGSEQVKQWRRGFS
TLPPALNLNDPRAPANDSLYATLNKNDLPLTESLATTVDRVVPYWDEVVKPRIIDGKRVI
IVAHGNSIRALVKYVDHLSEEEIMEINIPTAVPLVYEFNSSLQPINHYYLGNAEEITQKV
AAVAAQGKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaaaattaattttagtaagacatggtgagagtgaatggaacaaagaaaat
cgttttactggttgggctgatgttgatctatccgaaaaaggtcgtgttgaagcacaacag
gccggtaatttactaaaaaaaaaaggattctcttttgactttgcttacacttccgtttta
cgacgtgccactaatacgctttctctcattctagatgtactgcaacaacagaatctacca
atcgaaaaatcctggcgcctgaatgagcgtcattatggcgcactccaaggtctcaataaa
tcagagacagcggcaaaattcggatctgaacaagtgaagcaatggcgtagaggattttca
accttgcctcctgcattaaatttaaatgatccccgtgctcctgctaatgatagcctgtat
gctacactcaataaaaatgatctgccgctgacagagagcttagccaccaccgtcgatcgt
gtcgtgccttattgggatgaagtggttaagccccgtatcatcgatggaaaaagggtaatt
attgtcgctcatggaaattctattcgtgcgctcgtcaaatatgttgatcatttaagtgaa
gaagaaattatggaaattaatattccaacggccgttcctttggtgtatgaatttaattca
tctttgcagcctatcaaccattattatttaggcaacgcagaagaaattactcaaaaagtg
gctgcggtggcagctcaaggaaaagcttga

DBGET integrated database retrieval system