KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0290Help
Entry
HDEF_0290         CDS       T00911                                 

Gene name
serC
Definition
(GenBank) 3-phosphoserine/phosphohydroxythreonine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00270  Cysteine and methionine metabolism
hde00680  Methane metabolism
hde00750  Vitamin B6 metabolism
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_0290 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_0290 (serC)
   00270 Cysteine and methionine metabolism
    HDEF_0290 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HDEF_0290 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hde01007]
    HDEF_0290 (serC)
Enzymes [BR:hde01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     HDEF_0290 (serC)
Amino acid related enzymes [BR:hde01007]
 Aminotransferase (transaminase)
  Class V
   HDEF_0290 (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACQ67054
UniProt: C4K3B1
Position
293367..294473
Genome map
AA seq 368 aa AA seqDB search
MPLIYNFSAGPAMLPAEVVFQAEQELAERKKKGISVMEISHRSEFFQKIAKESEQDLKDL
LNIPSNYKVLFCQGGARGQFAAVPMNLLGEKKTADYITGGYWSKSAILEAKKYGVPNIID
ASVRKPISGVFFQSIKPISEWQLSEDAAYVHYCPNETIEGIAIHAPPIFSHHKDVVADFS
SSILSCPIDVDRYGVIYAGAQKNIGPAGLTVVIVRDDLLGKAHQHTPSILNYQVLADTQS
MFNTPPTFAWYLSGLVFKWLKDQGGLIEIQKRNREKAQLLYSTIDENEFYLNQVAPTHRS
LMNVPFSLSTSTPRLDELFLSEAKKRGLEGLKGHRAATGMRASIYNAMPVEGVQKLTEFM
VEFARRYG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgatttataattttagtgcgggtcctgccatgctgcccgcagaagtcgtattt
caagcagaacaggagctggctgaaagaaaaaagaaaggaatatcggtgatggaaatcagt
catcgaagtgaattttttcaaaaaatagcaaaagaatcagagcaggatctcaaagatctg
ttgaatatcccctcaaattataaagtgcttttttgccagggaggtgccagaggtcaattt
gcagcggttcctatgaatttattaggtgaaaaaaaaaccgcggactatatcactggagga
tattggtcaaaaagtgccattctggaagcaaaaaaatatggcgtcccgaatatcattgat
gccagtgttcgtaagccaatcagtggcgttttttttcaatccatcaaacccataagtgag
tggcaattaagtgaggatgccgcttatgttcattactgccctaatgaaaccatagaaggt
attgccattcatgcccccccgattttctctcatcataaagatgtggtggctgatttttct
tcttctattttatcttgccctattgatgtggaccgttatggggtgatttatgccggagct
caaaaaaatatcgggcccgctggcttgaccgtggtgattgttcgtgacgatcttttagga
aaagcccaccaacacactccctccattctcaattatcaggttcttgcagacactcagtct
atgtttaacaccccgccgacttttgcttggtacctctctggcttggtatttaagtggctc
aaagatcagggcgggctgattgaaatacaaaaacgtaatcgcgagaaggcccaattgctc
tattccaccatcgatgagaatgaattttacctcaatcaggttgcgcctactcaccgttca
ttgatgaatgtccctttttcattatcgacatctaccccaagattagatgagttgttttta
agcgaagctaaaaaaagaggattagaaggtttaaaaggccacagagcagcaacaggaatg
cgagcttctatttacaatgccatgcctgtagagggcgtccaaaagttaacggagtttatg
gttgagtttgcccggcgttatggttaa

DBGET integrated database retrieval system