KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0306Help
Entry
HDEF_0306         CDS       T00911                                 

Gene name
nrdB
Definition
(GenBank) ribonucleoside-diphosphate reductase 1, beta subunit
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00230  Purine metabolism
hde00240  Pyrimidine metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDEF_0306 (nrdB)
   00240 Pyrimidine metabolism
    HDEF_0306 (nrdB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hde03400]
    HDEF_0306 (nrdB)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     HDEF_0306 (nrdB)
DNA repair and recombination proteins [BR:hde03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    HDEF_0306 (nrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: ACQ67069
UniProt: C4K3C6
Position
complement(315578..316708)
Genome map
AA seq 376 aa AA seqDB search
MGYTTFSQKKNNQLLEPMFLGQTVNVARYDQQKYPIFEELIEKQLSFFWRPEEIDVSRDR
IDYQSLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWIETWAFSETIHS
RSYTHIIRNIVNDPSCIFDDIVTNNEILKRAKDISAYYDDLIKMTSYYHLLDEGTHQVNG
KTTVVNLYALKKQLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIKLIARDEA
LHLMGTQHMLDLMRSGKDDPEMADIAQECQQECSDLFLLAAQQEKEWAAYLFRDGSMIGL
NQDILCQYIEYMTNIRMQAVKLDAPFSIRTNPIPWINSWLVSDNVQVAPQEVEVSSYLVG
QIDAEIDSNDLKDFKL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgggctataccactttttctcagaaaaaaaataatcaattacttgaacctatgtttttg
ggtcaaacggtgaacgttgctcgatatgatcagcaaaagtatcccatttttgaggaatta
attgaaaagcaattgtcttttttttggcgtccagaagagattgatgtttcccgtgatcgt
attgactatcagtctttacctgaacatgaaaaacatatttttatcagtaatctcaaatat
caaactttattggattccatccaaggccgcagccctaatgtcgctttactccctctcatc
tccattccagaactcgaaacctggatagaaacctgggcattctcagaaaccattcactct
cgttcttacactcatatcatccgaaatattgttaatgatcccagctgtatttttgatgac
atcgtgaccaacaacgagattttaaaacgggcaaaggatatttctgcttattatgatgat
ttgatcaaaatgaccagctattaccatctattggatgagggtacccatcaagtgaatggc
aaaaccacagtggtcaatttatatgcgttaaaaaagcagctttatttatgtttgatgagt
gtcaatgcacttgaagccattcgtttttacgtgagctttgcttgttcttttgctttcgct
gaacgtaaattgatggagggcaatgccaaaattattaagctgattgccagagatgaagcg
ctacatctgatgggtactcagcatatgctggatttaatgcgatcagggaaagatgatcct
gaaatggctgacatcgctcaagaatgccagcaggaatgtagtgatttatttttgttggcg
gctcagcaagaaaaagaatgggcagcgtatttgtttcgggacggctcgatgatcggttta
aaccaggatattctttgccaatatatagaatatatgaccaacatccgcatgcaagccgtg
aaactcgacgcaccgtttagcattcgaactaatcctattccctggattaacagttggtta
gtctctgataatgtacaggttgcccctcaagaagttgaagtcagctcctatttggtgggg
caaattgatgctgagatagattcaaacgatctgaaagattttaaactttaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0307Help
Entry
HDEF_0307         CDS       T00911                                 

Gene name
nrdA
Definition
(GenBank) ribonucleoside diphosphate reductase 1, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00230  Purine metabolism
hde00240  Pyrimidine metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDEF_0307 (nrdA)
   00240 Pyrimidine metabolism
    HDEF_0307 (nrdA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hde03400]
    HDEF_0307 (nrdA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     HDEF_0307 (nrdA)
DNA repair and recombination proteins [BR:hde03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    HDEF_0307 (nrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC ATP-cone Ribonuc_red_lgN
Motif
Other DBs
NCBI-ProteinID: ACQ67070
UniProt: C4K3C7
Position
complement(316744..319032)
Genome map
AA seq 762 aa AA seqDB search
MNHSLLVTKRDGRKESIDLDKIHRVINWAAEGLNHVSVSQVELRSQIQFYDGIKTEDIHE
TMIKAAADLISCEAPDYQYLAARLAIFHLRKKAYGRFEPPPLFEHVSKMVKMGKYDPHLL
EDYSEDEFAQMDECIDHWRDMTFSYAAVKQLEGKYLVQNRVNHQIYESAQFLYILVAACL
FSRYPASTRLDYIKRFYHAISTFKISLPTPIMAGVRTPTRQFSSCVLIECGDSLDSINAT
ASAIVKYVSQRAGIGVNAGAIRAQGSPIRSGEAFHTGCIPFYKHFQTAVKSCSQGGVRGG
AATVFYPLWHLEVESLLVLKNNRGVEGNRVRHMDYGVQLNKLMYQRLLKGEEITLFSPSD
VPGLYAAFFSDQSEFQRLYVQYEADPDIRHKKIKAVELFSLLMQERASTGRIYVQNVDHC
NTHSPFDPKVAPVRQSNLCLEIALPTAPLNNINDEKGEIALCTLSAFNLGAINSLDELQE
LATLSARALDALLDYQHYPIPAAQRSAVSRRTLGIGVINFAYYLARNGVRYSDGSANNLT
HRTFEAIQYYLLRASNDLAREQGACPWFDQTRYAKGILPIDTYKKDLDDIHQEPLHYDWA
SLRQDILKFGLRHSTLSSLMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVPEYE
SLKEAYELLWNIPDNDGYLQLVGLMQKFVDQSISANTNYDPRRFSNGKVPMKQLLTDLLN
AYKWGIKTLYYHNTRDGADDVQADVKENLSMDDECSSGGCKI
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcttacttgtgactaagcgtgatggacgaaaagaatcgattgatctggat
aaaattcaccgggtgattaattgggcagcagaggggctcaatcatgtttcggtttctcag
gttgaattacgttctcaaattcagttttatgacggcattaaaactgaagatattcatgaa
accatgattaaagcggccgctgatttaatttcttgtgaagcgcccgattatcaatatctc
gctgcccgccttgctatttttcacctcagaaaaaaagcctatggccgttttgagccgccc
cctttatttgagcatgtttcaaaaatggtcaaaatgggaaaatatgatccccatcttttg
gaagactatagtgaagatgaatttgcacagatggatgaatgtattgatcactggcgagat
atgacgttctcttacgctgcagtcaagcaattggaagggaaatatctggtacaaaatcgc
gtgaatcaccaaatttatgaaagtgcacaatttttatatattttggtcgctgcttgtctg
ttttctcgttatccggcttcaacacgtttggattacatcaaacgcttttatcatgcgatc
tccacctttaaaatttctttacctacgccgattatggcgggtgtcagaacccccactcgt
caatttagctcgtgcgttttaattgaatgtggcgacagtctggattcgattaatgcgact
gccagcgcgattgtcaaatatgtgtcacagcgtgcagggatcggtgtgaatgcgggcgct
atccgtgctcagggcagccctattcgctccggtgaagcctttcataccggttgcattcct
ttttataaacattttcaaaccgcggtcaaatcctgctctcaaggaggggtacggggtggc
gctgccactgttttttatcctttatggcatcttgaagtcgaaagtttgcttgtgctgaaa
aataaccgaggcgttgaaggcaatcgagtgcgtcatatggattatggcgtgcaactcaat
aaattgatgtatcagaggttgttaaaaggagaagagatcacgctgtttagcccttcagat
gtgccaggcttatatgcggcttttttctcagatcaaagtgaatttcagcggctctatgtg
caatatgaagccgaccctgacattcgtcataagaagatcaaggcggtcgagcttttttct
ctgctgatgcaagagagggcatcaacaggccgtatttatgtccaaaatgtggatcactgt
aacacgcatagcccttttgatcccaaagtcgcgcccgttcggcaatctaatctgtgcctg
gagattgcgttaccgaccgccccgctcaacaatatcaatgacgaaaaaggggaaattgcc
ctttgcacgctctcggcgtttaatctgggtgccatcaacagcctggacgaactccaggaa
ttagccactctttctgcgcgcgccttagatgccttattagattatcagcattacccgatt
ccggcggcacagagaagcgcggtttcgcgccgcactctgggtattggtgtgattaatttt
gcgtattatttagccaggaatggggttcgttattctgatggcagtgccaataatttgacc
catcgtacttttgaagccattcaatactatcttcttcgggcttctaatgatttggcacgt
gaacaaggggcttgcccctggtttgatcaaacccgttacgctaaaggcattttgcctatc
gatacctataaaaaagatcttgatgatatccaccaggagcccctgcattatgattgggca
tctttgcgtcaagatattcttaagtttggtttacgtcattctacgctgtcctctctaatg
ccttctgagacctcatcacaaatttctaatgccaccaatggcattgaaccgccgagaggt
tatgtcagcattaaagcctcaaaagacggtatcttgcgccaggttgttccagaatatgaa
tctttaaaggaagcgtacgagctgttatggaatattcctgataatgatgggtatcttcag
ctggtggggttaatgcaaaaatttgtggaccaatcgatttctgccaatacgaattatgat
ccacggcgtttttctaacggtaaagtaccgatgaaacaattattaaccgatcttttaaac
gcttataaatgggggatcaaaacgctgtattatcacaatacacgtgatggtgcagatgat
gtgcaggctgatgtcaaagaaaatctatcgatggatgatgagtgttccagcggtggttgt
aaaatttaa

DBGET integrated database retrieval system