KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0322Help
Entry
HDEF_0322         CDS       T00911                                 

Gene name
crr
Definition
(GenBank) PTS family enzyme IIA component
  KO
K02777  PTS system, sugar-specific IIA component [EC:2.7.1.-]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00500  Starch and sucrose metabolism
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
hde02060  Phosphotransferase system (PTS)
Module
hde_M00265  PTS system, glucose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0322 (crr)
   00500 Starch and sucrose metabolism
    HDEF_0322 (crr)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0322 (crr)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_0322 (crr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_0322 (crr)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     HDEF_0322 (crr)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00265]
    HDEF_0322 (crr)
   Maltose/glucose-specific II component [MD:M00266]
    HDEF_0322 (crr)
   Maltose-specific II component [MD:M00806]
    HDEF_0322 (crr)
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component [MD:M00272]
    HDEF_0322 (crr)
   Trehalose-specific II component [MD:M00270]
    HDEF_0322 (crr)
   N-Acetylmuramic acid-specific II component [MD:M00303]
    HDEF_0322 (crr)
   Alpha-glucoside-specific II component [MD:M00268]
    HDEF_0322 (crr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ACQ67084
UniProt: C4K3E1
Position
complement(332270..332782)
Genome map
AA seq 170 aa AA seqDB search
MGLIDKLKSWLSSDDKQLNRIIDIYSPISGEIIPIEQVPDVVFAEKIVGDGIAIKPTGSK
IRAPIDGTIGKIFETNHAFSMQSDNGIELFVHFGIDTVELKGEGFKRIGKEGQYVQKGEV
ILEFDLPLLLNKAKSCLTPVVISNMDEMKEMIKLTGQVKAGETPILRIRK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggggttgatcgataaattaaaatcatggctttcatcagatgataaacaattaaataga
atcattgatatttattctcctatatctggggaaattattccaattgaacaggtcccggat
gttgtttttgctgaaaaaattgtaggtgacggtattgctatcaaacctacaggcagcaaa
ataagagcgccgattgacggcaccattggaaaaatttttgaaaccaatcatgctttttct
atgcaatccgataatggtattgagctttttgttcattttggtattgatactgttgagcta
aaaggcgaagggtttaaacgtattggaaaagaaggccagtatgttcaaaaaggagaggtg
attcttgaatttgatctgccgctacttttaaataaagcgaaatcctgtctcacgcctgtt
gtaatttctaatatggacgaaatgaaagagatgataaaactcacaggtcaagtcaaagca
ggtgaaacgcctattcttcgtattagaaaataa

DBGET integrated database retrieval system