KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0382Help
Entry
HDEF_0382         CDS       T00911                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0382 (pckA)
   00020 Citrate cycle (TCA cycle)
    HDEF_0382 (pckA)
   00620 Pyruvate metabolism
    HDEF_0382 (pckA)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     HDEF_0382 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ACQ67138
UniProt: C4K3J5
Position
386842..388461
Genome map
AA seq 539 aa AA seqDB search
MHNINHLLNTLTDYGIHNTGKIFYNPSYSILFQEETRDTLVGFERGTVTKLGAVAVDTGI
FTGRSPKDKYIVRDDITRDTFWWADQGKNKSDNHPITQAIWNELKTCVTQQLSNKPLFVV
DAFCGAHSNSRLQVRFITEVAWQAHFVKNMFIRPSEEELTRFHPDFVVMNGAKCTNPNWK
EQGLHSKNFVAFNLTERIQLIGGTWYGGEMKKGLFSMMNYFLPLKRIAAMHCSANVGVKG
DVAVFFGLSGTGKTTLSADPKRQLIGDDEHGWDDEGVFNFEGGCYAKTIELSESDEPDIY
HAIKRDALLENVVVLPDATVDFNDSSKTQNTRVSYPIYHIQNIVQPVSKAGHAKKIIFLT
ADAFGVLPPVVHLTLEQTQYHFLSGFTSKLAGTELGITSPVPTFSACFGEAFLSLHPTQY
AEVLLQRMQAAQAKAYLVNTGWNGMGHRISIKNTRAIIEAILHEKIDHVPTFNLPIFNLS
VPTEIEGVNSEILDPRASYSEVKEWQHKAENLARRFIKNFEQYSDTAVGALLLKSGPEL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatatcaaccatcttttgaatacattaactgattatggcattcataataccggt
aagattttttataaccccagctattccatattatttcaagaggaaacacgagacactttg
gtgggtttcgaacgtggaacagtgactaaattaggcgccgtggctgtggatacgggcatc
ttcaccgggcgttctcctaaagataaatatatcgtccgtgacgatatcactcgagatact
ttttggtgggcagatcaaggcaaaaataaaagcgataatcaccccatcactcaagccatt
tggaatgaactcaagacctgtgtcactcagcaactttcaaacaaacctttatttgtggta
gatgccttttgtggcgctcattcaaacagtcgtttgcaagtacgatttattactgaagtc
gcttggcaggcgcattttgttaaaaatatgtttattcgcccttcagaagaagaactcact
cgttttcatcctgattttgtggtcatgaatggcgccaaatgtactaacccaaattggaaa
gaacaaggtttacactccaaaaattttgtggcctttaatttgactgaacggattcaactg
attgggggcacttggtacggaggtgaaatgaaaaaaggattgttttcaatgatgaattat
tttttgccattaaaaagaattgctgccatgcactgctctgcaaatgtcggagttaaagga
gatgttgctgttttctttggtttatccggcaccggaaaaaccactttatctgccgatcct
aaaagacaacttatcggtgatgacgaacatggttgggatgacgaaggtgtttttaatttt
gaaggaggttgttatgcaaaaacaattgaattgtccgagtcagatgaacccgatatttat
cacgcaatcaaaagagatgctttactggaaaacgtggtggttttgccagatgccaccgtc
gattttaacgatagttcaaaaacccaaaataccagggtgtcttatcctatttatcacatc
caaaatattgtgcaaccggtatcaaaagcaggccatgcaaaaaaaattatttttttaaca
gcggatgcttttggcgttttacctcctgttgttcatttaactctagaacaaacccagtat
cattttttatcgggtttcacatcaaaactggcaggaacagagctcgggatcaccagccca
gttcccactttttcagcttgctttggagaggcgtttctttcacttcatcctactcaatat
gctgaagtgcttttacaaaggatgcaagcagcgcaggcaaaagcgtatttggtcaataca
ggctggaatggtatgggtcatcgtatttctattaaaaatactcgagcgattattgaggca
attctacatgaaaagattgatcacgtgcccacctttaatttgccgatttttaacctcagt
gttcctactgaaatcgaaggggtaaactcagaaattttagatcctcgcgccagttattct
gaggtaaaagaatggcaacacaaagcagaaaacttggcacggcggtttatcaaaaatttt
gaacaatacagcgataccgctgtaggggcgttgttactgaaatcaggcccagagttatag

DBGET integrated database retrieval system