KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0445Help
Entry
HDEF_0445         CDS       T00911                                 

Gene name
fabH
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP transacylase
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde01100  Metabolic pathways
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0445 (fabH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0445 (fabH)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     HDEF_0445 (fabH)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0445 (fabH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N FAE1_CUT1_RppA Chal_sti_synt_N HMG_CoA_synt_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACQ67199
UniProt: C4K3Q6
Position
448997..449941
Genome map
AA seq 314 aa AA seqDB search
MQTNILGTGSYLPETVRTNSDLEKMVDTSDEWIFTRTGIRERRIAASSETVASMGFYAAT
EALKMAQIDQNDIGLIIVATTSSSHAFPSSACQIQEMLGIKDSISFDLAAACAGFIYALS
VADQYIKSGTISYALVIGSDLLTQSLDLKDRSTVILFGDAAGAVVLGASDQPGIISTHLH
ANGHYGKLLTLFYPREKNSPFISMAGNEVFKVAVLELASVVHEALKSNQLDASELDWLIP
HQANIRIINATAKKLNIGMEKVVITLDRHGNTSAASVPSALDEAVRDGRIQRGQLLLLEA
FGGGFVWGSALVRF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcagactaacatactcggtacagggagttatctacctgaaacagtgcgtaccaattca
gatttagaaaaaatggtagacacttcagatgaatggattttcaccagaacaggcattcga
gaaaggcggatcgctgcctcttctgaaacagtcgccagcatgggtttttatgctgcaaca
gaagccttaaaaatggctcaaattgaccaaaatgacattggcttaattattgtggctacc
acttcttcaagtcatgcttttccaagttcagcctgtcaaatacaagaaatgttaggcatt
aaagacagcatttcttttgacttggctgccgcctgtgcgggttttatttacgctctcagt
gttgctgatcaatatattaaaagtggcacaatatcctatgcattggtgatcggttctgat
ttgctgacacaatctcttgatcttaaagatcgcagtactgttattttattcggggatgcg
gcaggggcagtcgttttaggtgcctcagatcaaccaggtattatttcaactcatttacac
gcaaatgggcactacggaaaactactcactctattctatcccagagaaaaaaattcgcct
tttatcagcatggctggaaatgaagtatttaaagtggccgtacttgaattagcaagcgtt
gttcatgaagccttaaagtccaatcaattggatgcttcagaactagattggttgataccc
catcaagctaacatccgtattattaacgccacagctaaaaagttgaatataggcatggaa
aaagtggtcattactttagatcggcacggtaatacttctgctgcatcagtgccatccgca
ttagatgaagcggtacgcgatggccggatccaacgagggcaactacttcttttggaagcc
tttgggggtggttttgtctggggatctgcgttagttcgtttttag

DBGET integrated database retrieval system