KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0446Help
Entry
HDEF_0446         CDS       T00911                                 

Gene name
fabD
Definition
(GenBank) malonyl-CoA-[acyl-carrier-protein] transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde01100  Metabolic pathways
hde01130  Biosynthesis of antibiotics
hde01212  Fatty acid metabolism
Module
hde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0446 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HDEF_0446 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0446 (fabD)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     HDEF_0446 (fabD)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0446 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 MyTH4
Motif
Other DBs
NCBI-ProteinID: ACQ67200
UniProt: C4K3Q7
Position
449961..450935
Genome map
AA seq 324 aa AA seqDB search
MTTFAILFPGQGSQSLGMLSSMAKTFPLIIKTFSQASDALGYDLWALTQEGPVSELNKTW
KTQPALLTASVAIWRVWKAEGGPSPFMVAGHSLGEYSALVCAGVLNLTETVKLVELRGKL
MQAAAGEGAMSAIIGLDDETIVKICKQTAQNQVVSPANFNSQWQVVISGHKEAVERANIA
CIAAGAKKVFPLSVSVPSHCALMKPAADKLLAELNKMVFKTSKFPVLNNADVKVENSPEH
IREALVRQLYSPIPWVKSIQFMIQKGVGSFLELGAGNILSGLNKRIVHKAPAFSVNDAHS
LAHALNYVSGKSVNKILKEDIYEI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatttgcaatcctttttccaggtcagggttctcaatcattggggatgctttcg
agtatggcgaaaacatttcctttgataataaaaactttttctcaagccagtgatgctctt
ggttacgatctttgggcgctcacacaagaggggcctgtatcagaattaaataaaacatgg
aaaacacaacccgctttactcacggcttctgtggccatctggcgggtttggaaagcagaa
ggcggcccctctccatttatggtggcaggccatagtctaggagaatattccgccttagtg
tgtgccggtgtcttgaatttgacagaaacagtaaagctggttgaattaagaggaaaatta
atgcaagccgccgcaggcgagggagccatgtctgctatcattggactcgatgatgaaact
atagtgaaaatttgcaaacaaacagcacaaaatcaggttgtttcacccgcaaattttaat
tctcaatggcaagtcgtgatttctggccataaagaagcagtagaacgagctaatattgcc
tgtatcgcagcgggagcaaaaaaggtcttccccttatcggtgagtgtgccttctcattgt
gccttgatgaagccggcggcggataagttgttggctgagctgaataaaatggtgtttaaa
acgtcaaaatttccggtgctcaacaatgcggatgtcaaagtagaaaattcacctgaacat
atccgagaggcattagtacgtcaattgtattctccaataccttgggttaaaagtatccaa
tttatgattcaaaaaggtgtgggatcttttttagagttgggggcgggaaacattttatcc
ggtctgaataaacgcattgtgcataaagcacctgctttttcagtcaatgacgctcattca
ttggctcatgctcttaattatgtttcaggaaaatctgtgaacaagattttaaaagaggat
atatatgagatttaa

DBGET integrated database retrieval system