KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0447Help
Entry
HDEF_0447         CDS       T00911                                 

Gene name
fabG
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00780  Biotin metabolism
hde01100  Metabolic pathways
hde01130  Biosynthesis of antibiotics
hde01212  Fatty acid metabolism
Module
hde_M00083  Fatty acid biosynthesis, elongation
hde_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0447 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HDEF_0447 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HDEF_0447 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0447 (fabG)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     HDEF_0447 (fabG)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0447 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 LDcluster4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACQ67201
UniProt: C4K3Q8
Position
450925..451662
Genome map
AA seq 245 aa AA seqDB search
MRFKGKIALITGATRGIGRAIAQSLTEEGAFVIGTATTEEGAKKVSDDLGDYGKGVTLNV
IDEESIEALIKSIEEEFCGPDILVNNAGITRDGLLMRMKTNSWNEVLGTNLTSIFYLSRA
ALRPMMKKRFGRIINIGSVVGSAGNVGQTNYTAAKAGLIGFSKSLAQEVAQRGITVNVVA
PGFIETDMSRQALTETRRTEILKKIPMNRLGDVKDIANAVAFLASDQSSYITGETLHING
GMYMI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaaggaaaaattgcattgattactggcgcaactcgtgggattggtcgcgct
atagcccaatcattaacagaagagggtgcttttgtaataggcacggcgaccactgaagag
ggtgcaaaaaaagtcagcgatgatttaggtgactatggtaaaggcgtcaccttaaacgtg
attgacgaggaatccattgaagcattaataaagagcattgaagaggaattttgtggccct
gatatcttggtcaataatgcaggtattacacgtgatggtttgctgatgcgtatgaaaaca
aacagttggaatgaggttttgggcacaaatttaacatccatattttatctttcacgagcc
gctttacgccccatgatgaaaaagcgctttggtcgtattatcaatataggatccgtagta
ggcagtgcgggaaatgtagggcaaaccaattacactgctgctaaagccggcctaattggt
tttagtaaatctcttgctcaagaagtcgctcaaagaggcatcacggttaatgtggtcgca
cctggatttattgaaacggatatgtctcgacaggcgttaacagaaactcgacgcactgaa
attttaaaaaaaattcccatgaatcgattgggtgatgttaaggatattgcgaatgcagtg
gcttttttagcctctgatcaaagcagttatattaccggtgaaaccttacatattaatgga
ggcatgtatatgatttaa

DBGET integrated database retrieval system