KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0477Help
Entry
HDEF_0477         CDS       T00911                                 

Definition
(GenBank) putative GTP-binding protein
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00730  Thiamine metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HDEF_0477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hde03009]
    HDEF_0477
Enzymes [BR:hde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     HDEF_0477
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     HDEF_0477
Ribosome biogenesis [BR:hde03009]
 Prokaryotic Type
  GTPases
   HDEF_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase MMR_HSR1 FeoB_N Trp_repressor AAA_16 AAA_29 ABC_tran MMR_HSR1_Xtn Arf
Motif
Other DBs
NCBI-ProteinID: ACQ67231
UniProt: C4K3T8
Position
476766..477824
Genome map
AA seq 352 aa AA seqDB search
MKKNKLSKNQHRRIQAHHQYRLHPTSLTDDKNNQLDDAQFGEPQQGVVISRFGQHADVEG
HQGQQQRCHIRRNVLSLVTGDRVIWRPGIPRQENRNVKGIVEAVHERKSVLTRPDFYDGI
KPMAANIDQIVIVSAVIPDLSLNMIDRYLVVSESLNIKPLLLLNKIDLLTPNERKKINLR
LNIYRNIHYTVLEVSAQTGEGIADLQANLLDRVSIFSGQSGVGKSSLLNTLLPPTEQQIL
VEALSEKSALGQHTTTTSRLYHFQQGGDLIDSPGIREFGLWHLTQEQIIQGFIEFRDYVG
HCKFRDCAHIDDPCCALRDAVQKGHIAKERFDNYHQILSEITLKGKKLFNQD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaaataaactctcaaaaaatcaacaccgccgtattcaggctcatcatcaatat
cgactccatccgacatctctcacggacgataaaaacaatcaattagacgatgctcaattt
ggtgaaccacaacaaggggtcgtcattagccgttttggtcagcacgcagatgtagaaggt
catcagggtcaacaacaacgctgtcatatccgaaggaacgtgctttctttagtgacaggt
gacagagtgatctggagacctggtataccaaggcaagaaaaccgcaacgtaaaaggtatt
gtagaagctgttcatgaacgaaaatctgtcttaacacgccccgatttttatgacggtatt
aaaccgatggcagcgaacatcgatcagatcgtcatagtctcagcagtgatccctgattta
tcacttaatatgattgatcgttatttggtggtctctgaaagtttaaatataaagccgctc
ctccttttaaataaaattgatttattaacacccaatgaacgaaaaaaaatcaatctcagg
ctgaatatttatcgaaatattcattacactgttcttgaagtgtcggctcaaacaggcgaa
ggaatcgctgatttacaagcaaatttattagaccgtgtcagtattttttctggtcaatcg
ggcgtaggaaaatcgagtttattgaacactttgttgcccccgactgaacagcaaatcctg
gttgaagccctttcagaaaaatccgccctgggtcaacatactacgacaacaagtcgtttg
tatcattttcaacaaggaggagatttgattgattcacccgggatcagagaatttggtctt
tggcatttaacccaagagcaaattatccagggttttattgaatttcgtgattatgttggg
cattgtaaattcagagattgtgcacacatcgatgatccctgttgtgccctgcgtgatgcc
gttcaaaaaggccatatcgctaaagagcgttttgataactatcatcaaattttgtcggaa
atcactttgaaaggcaaaaaactttttaatcaagattaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1928Help
Entry
HDEF_1928         CDS       T00911                                 

Gene name
thiL
Definition
(GenBank) thiamin-monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00730  Thiamine metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HDEF_1928 (thiL)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     HDEF_1928 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C
Motif
Other DBs
NCBI-ProteinID: ACQ68516
UniProt: C4K7H3
Position
complement(1762987..1763994)
Genome map
AA seq 335 aa AA seqDB search
MPRSEFDLISRYFNRKSFIREDVELGIGDDCALLSTEKKRRIAVSTDTLVSGVHFLPDID
PADLAYKAFMINLSDLAAMGAEPAWLSLALTLPRIDEPWLQTFSDMLFEQLEAYRMQLIG
GDTTRGPLSLTLTIQGLLIEKGGLTRSGAKKGDGIYVTGTLGDSAAGLAILKNTVTISDE
ADKRFLIKRHLRPQARIFQGKALNGLAHSAIDISDGFISDLQHILNASQCGAHIELSQLP
YSPALKTYSNHEQALRWALSGGEDYELCFTLSPQYSHILENLFQRCRGPEVFYTKVGEVV
SDFSGKITFFRDGEPVSMKISNITGYDHFDTYRRE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcagtgaatttgacctgatttctcgctattttaatcgaaaaagttttattcgt
gaggatgtcgagctcggcataggagatgattgcgctttactttctactgaaaaaaaaagg
cgaatcgcggtcagtacggacacattggtttccggggtgcattttttaccagatattgat
cccgctgatttggcttataaagcctttatgatcaatttaagtgatttggcggccatgggg
gctgagcctgcctggttgtctttggcgttaactttgccgcgtatcgacgaaccctggtta
caaacatttagcgatatgctttttgaacaacttgaagcgtatcgcatgcagttaattggc
ggagataccacccgtgggcctttaagccttactttaaccattcagggcctattgattgaa
aagggaggattaacccgcagcggagcaaaaaaaggcgatggaatttatgtcacaggcact
ttaggtgacagcgccgccggtttagccatcttaaaaaataccgtgactatcagcgatgag
gctgacaagcgttttttgattaagcgccatttacgcccacaagcgaggatatttcaagga
aaggcgttgaacggtttagcccattcagcaattgacatctcagatggatttatctctgat
ttacaacatattttaaatgccagtcaatgcggggctcatattgaattatctcaattgcct
tattcgcctgctttaaaaacatattcaaatcatgaacaagccctgcgttgggctttgagt
ggtggcgaggattacgagctttgttttactctctcacctcaatactcacacattttagaa
aacctgtttcagcgatgcagaggccctgaagtgttttatacaaaggtgggtgaagttgtg
tcggacttttctggaaaaatcacattttttcgtgatggagagccggtttcaatgaagatc
tccaatatcacaggttacgatcattttgatacttaccgcagagaatag

DBGET integrated database retrieval system