KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0506Help
Entry
HDEF_0506         CDS       T00911                                 

Gene name
metK
Definition
(GenBank) methionine adenosyltransferase 1 (AdoMet synthetase)
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_0506 (metK)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     HDEF_0506 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: ACQ67260
UniProt: C4K3W7
Position
507011..508168
Genome map
AA seq 385 aa AA seqDB search
MPHQLFTSESVSEGHPDKIADQISDAVLDAILIQDPKARVACETYVKTGMVIVGGEITTS
AWVDIEEITRCTLAEIGYVHSDMGFDAHSCAVLSAIGKQSPDINQGVDRIDPLDQGAGDQ
GMMFGYATNETDVLMPAPITYSHRLVKRQSEMRKIGQLPWLRPDAKSQITFKYDKGYAVA
IDTIVFSTQHEEDVTQKQLEEAVMEEIIKPVIPTQWLSSSTKYFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQIS
YAIGVANPTSIMLETFGTEKITIQKIMSLIHQHFDLRPYGLIKMLDLLKPIYRATAAYGH
FGRDVFPWEATDKAELLREQAGLNQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcagctatttacttctgaatctgtttctgaaggacacccagacaaaatcgcg
gatcaaatttctgacgccgtattagacgctattttaattcaagatcctaaagcccgtgtg
gcctgtgaaacctatgttaaaaccggtatggtcattgtaggtggagaaataaccacttct
gcctgggtggatattgaagagatcacgcgttgtacccttgctgaaattggttatgttcat
tctgatatgggttttgatgcgcattcttgtgctgtgctcagcgccattggaaaacagtca
cccgacatcaatcaaggggttgaccgtatagatccgctggatcaaggtgcaggagatcaa
ggaatgatgtttggctacgcgaccaatgaaaccgatgttttaatgcctgcgcccattact
tattcacatcgtttggtgaagcgtcaatctgagatgcgaaaaataggtcagttgccttgg
ttgcgtccagatgcaaaaagtcagatcacgtttaaatatgataaaggctatgctgtagcg
atcgatactattgtgttctctactcagcatgaggaagatgtcactcaaaaacaattagaa
gaagctgtgatggaggaaatcattaaacccgtgataccgactcaatggctttcaagcagt
acaaaatattttattaatccaaccggtcgttttgtgatagggggccctatgggagattgt
ggtttaaccggtcgcaaaattattgtcgatacttatggcggcatggctcgccatgggggc
ggtgcattttctggaaaagatccctctaaagtggatcgttctgccgcttatgcagcacgt
tatgttgcaaaaaatatcgtcgcagcaggattggccgatcgctgtgaaattcaaatttct
tacgcgattggtgtcgcaaatcctacttctattatgctcgaaacctttggcaccgaaaaa
ataaccattcaaaagatcatgagtttaatacaccaacattttgatctcagaccctatggt
ttgatcaaaatgttagatctactaaagcctatttatcgtgcgactgccgcatatggtcac
tttgggcgtgatgtttttccttgggaagcgaccgataaggctgagttgcttagagaacaa
gcgggtttaaatcaatag

DBGET integrated database retrieval system