KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0511Help
Entry
HDEF_0511         CDS       T00911                                 

Gene name
speD
Definition
(GenBank) S-adenosylmethionine decarboxylase, proenzyme
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde00330  Arginine and proline metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_0511 (speD)
   00330 Arginine and proline metabolism
    HDEF_0511 (speD)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     HDEF_0511 (speD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AdoMet_dc
Motif
Other DBs
NCBI-ProteinID: ACQ67265
UniProt: C4K3X2
Position
complement(510800..511594)
Genome map
AA seq 264 aa AA seqDB search
MNKLKLHGFNNLTKSLGFCIYDICYAQTFADRDGYIAYIDDEYNADRLTEILRETCSIIG
ANILNIARQDYNPQGASVTILISEEAIDPRDVDTSEHPGPLPDSIVAHLDKSHICVHTYP
ESHPTEGLCTFRADIEVSTCGIISPLNALNYLIHQLESDIVTIDYRVRGFTRDVNGVKHY
IDHQINSIQNFMCKDIQSLYHMMDVNVYQENIFHTKMMLKDFDLKHYLFNSHPEQLSVQE
KDLITKRLYKEMQEIYYGRNVVEV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaactgaaactacatggtttcaataatttaaccaaaagcctgggattttgtatt
tatgatatttgttatgctcaaacgtttgctgaccgtgatggctatattgcttatatcgat
gacgaatataatgccgatcgtttaaccgaaatattaagggagacctgctccattataggt
gcaaatattttaaatatcgctcgccaggattacaatccgcaaggggccagtgtcactatt
ttaatcagcgaagaagcgattgatccacgtgatgtcgatacttccgaacacccggggcct
ttgcccgattctattgtggctcatttagataaaagccatatttgtgtgcatacctatcca
gaaagtcatccaaccgaggggttatgtacctttcgggccgatattgaagtgtcgacctgc
gggattatttcgcctttgaatgcattaaattatttaatccaccagcttgaatcagatatt
gtgaccatagattaccgtgtgagggggtttactcgtgatgtgaatggggtcaagcattat
atcgatcaccaaattaactccatccagaattttatgtgtaaagatatacaatcgctttac
catatgatggatgtcaatgtttatcaagaaaacatatttcacacaaagatgatgttgaag
gactttgatctcaagcattatctctttaattcacatccagagcagctgagcgttcaagaa
aaagatctcatcacaaagaggctatataaagaaatgcaggaaatttactatggacgaaat
gtggtggaagtgtag

DBGET integrated database retrieval system