KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0512Help
Entry
HDEF_0512         CDS       T00911                                 

Gene name
speE
Definition
(GenBank) spermidine synthase (putrescine aminopropyltransferase)
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde00330  Arginine and proline metabolism
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_0512 (speE)
   00330 Arginine and proline metabolism
    HDEF_0512 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDEF_0512 (speE)
   00480 Glutathione metabolism
    HDEF_0512 (speE)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     HDEF_0512 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 Methyltransf_11 Pox_MCEL MTS
Motif
Other DBs
NCBI-ProteinID: ACQ67266
UniProt: C4K3X3
Position
complement(511668..512540)
Genome map
AA seq 290 aa AA seqDB search
MSQKQLWYEKLHSSFGQYFSIKEVLYRDKTDHQDLIIFDTEEFGRVMALNHVVQTTERDE
FIYHEMMTHVPLLAHGDAKKVLIIGGGDGGILREVCRHAGVKEIIMVEIDQDVVNLCQEY
FPHHHAGAYDDPRFQLKIDDGAHFVEQTNHRFDLIISDSTDPIGPGEHLFKSSFYQACRR
ILNAGGLFVAQNGVCFLQQTEVINTYQRLMPYFSDVSFYQAAIPTYYGGIMTFAWASENA
NLRRIGLNDLESRFADSGLKSCRYYNPFVHFASFALPQYLIEALAKKAPK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaacagctttggtatgagaaattacattcctctttcggccaatatttttcc
atcaaagaagtgttgtaccgcgataaaacggatcatcaggatttgattatcttcgacact
gaagagtttggccgggtgatggccttaaatcatgtggtgcaaacaacagagcgtgatgaa
tttatttatcatgagatgatgacacacgtccctttactggctcacggtgatgctaaaaaa
gtcttaatcatagggggaggagacggggggattttacgtgaagtgtgccgccatgccggt
gttaaagaaattatcatggtcgaaattgatcaagatgtggtcaatttatgccaagaatat
tttcctcaccatcatgcaggggcttatgatgatccgcgatttcagttgaaaattgatgat
ggcgcgcattttgtcgagcaaacaaatcatcgctttgatctgatcatttcggatagcacc
gatccgatagggccaggtgaacatttatttaagtcttcgttttatcaagcatgccgtcgt
atcttgaatgcagggggtctctttgtagctcaaaatggcgtgtgttttttacaacaaaca
gaagtcatcaatacgtatcaacgcctgatgccttatttttctgatgtgagtttttaccaa
gccgctattcctacttattacgggggaatcatgacattcgcctgggcttcagaaaatgca
aatttacgtcgaattgggctgaatgatttagaatcccgctttgctgattcaggcctaaaa
agttgtcgttactataatccttttgtacactttgccagttttgcccttcctcaatattta
atagaagcattggcgaaaaaagcgcctaaatga

DBGET integrated database retrieval system