KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0526Help
Entry
HDEF_0526         CDS       T00911                                 

Gene name
nadB
Definition
(GenBank) quinolinate synthetase, B protein (L-aspartate oxidase)
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00250  Alanine, aspartate and glutamate metabolism
hde00760  Nicotinate and nicotinamide metabolism
hde01100  Metabolic pathways
Module
hde_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDEF_0526 (nadB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HDEF_0526 (nadB)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     HDEF_0526 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like Lycopene_cycl NAD_binding_8 Retrotrans_gag NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACQ67280
UniProt: C4K3Y7
Position
complement(523009..524619)
Genome map
AA seq 536 aa AA seqDB search
MKKLSEQMTDVLIIGSGAAGLSLALRLAPHCRITLLSKELLNEGATFYAQGGIAAVFDEA
DSISSHVQDTVISGSGLCDQEIVEFVASHASQCIQWLVHQGVLFDTEINSIGQERYHLAR
EGGHTHRRILHSADATGKEVENTLIKKVLDHPNICIRERHNAVDLITSGKMGNTENQRIV
GAYVWNRDSKQVETFRSKIVVLATGGAAKVYQYTTNPEISSGDGIAMAWRAGCRVANLEF
NQFHPTCLFHPKAPNFLLTEALRGEGAYLKRPDGSRLMPDFDARLELAPRDIVARAIDHE
MKRLGADCMYLDISHKSSEFIVQHFPMIYQKLLSLGINLTKEPIPVVPAAHYTCGGVMVN
RQGRTDLEGLYAIGEVSYTGLHGANRMASNSLLECLVYAWSAAEDILAHLPQSHLSDVLP
DWDESRVHNSDEQVVIQHNWHELRLFMWDYMGIVRTTKRLERALRRINTLKQEVNEYYTH
FRISNHLLELRNLLQTAELMVRCAMMRKESRGLHYTLDYPNQLQKPQLSILSPLKG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattatctgaacaaatgaccgatgtattaatcattggcagtggtgctgcaggt
ttatcattagcgttacgtcttgctccacattgtcgcatcacccttctcagtaaggaatta
ttaaacgaaggggccaccttttatgctcagggaggtatcgcggcagtttttgatgaagca
gatagtatcagctcacatgtgcaggataccgtgatcagcggttcagggctgtgcgatcaa
gagattgtcgaatttgtcgccagtcatgcctctcaatgtatacaatggctggttcatcag
ggtgttctatttgatactgaaataaattcgatcggccaagagcgctatcatttagctcgt
gaaggaggtcatacacatcggcgtattttacacagtgccgatgcgacgggcaaagaagta
gaaaatactttaatcaaaaaagtcttggatcaccccaatatttgtatacgagaacgccat
aacgcggtggatctcattacttcaggcaaaatgggcaatactgaaaatcaacgaattgtt
ggcgcttatgtttggaatagagatagcaagcaggtagaaacctttcgctcgaaaatagtt
gtactagcgacagggggagccgccaaggtttatcaatataccaccaatcctgaaatttct
tctggtgatggaattgccatggcttggcgtgcaggatgcagagtggctaatctagaattt
aatcaatttcaccctacctgtttgtttcatcctaaagcccctaattttttattaacggaa
gccttgcggggtgaaggggcttatttaaagcgacctgatggtagtagattgatgcctgat
tttgatgcgcgccttgaattagcccccagggatattgtggctcgagccattgatcatgaa
atgaaaaggcttggagcagattgcatgtatctcgatatcagccataaatctagtgaattt
attgttcaacattttcctatgatttatcaaaaattgctttcattaggaattaatttaacg
aaagaacccatcccggttgtgcctgctgcacattatacttgtggaggagttatggtgaat
cgccagggacgtacagatctggaaggcttatatgccatcggtgaagtcagttatacgggt
ttgcatggagccaaccgtatggcctctaattcgttactggaatgtttggtgtatgcttgg
tcagccgccgaggatattttggctcatttacctcaatcacatctgagcgatgtactacct
gattgggatgaaagcagggttcataattctgatgagcaagtggtcatccaacataactgg
catgaattacgcttatttatgtgggattatatgggaattgttcgtaccactaaaagattg
gaacgggcgttgcgtcgtattaatactttaaagcaggaagtgaacgaatattacactcat
ttccgtatctctaatcatttgctggaattgcgtaatttattacaaaccgcagaactgatg
gttcgttgtgccatgatgcgaaaggagagcagaggtttacattacacgttggactacccc
aatcaactacaaaaaccgcaattgagtattctttctcctttaaaagggtag

DBGET integrated database retrieval system