KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0538Help
Entry
HDEF_0538         CDS       T00911                                 

Gene name
ugd
Definition
(GenBank) UDP-glucose 6-dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00040  Pentose and glucuronate interconversions
hde00520  Amino sugar and nucleotide sugar metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDEF_0538 (ugd)
   00053 Ascorbate and aldarate metabolism
    HDEF_0538 (ugd)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0538 (ugd)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     HDEF_0538 (ugd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C Semialdhyde_dh NAD_Gly3P_dh_N F420_oxidored Ldh_1_N ApbA TrkA_N 3HCDH_N Prenylcys_lyase GFO_IDH_MocA Pyr_redox NAD_binding_7 DAO NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACQ67291
UniProt: C4K3Z8
Position
complement(534870..536036)
Genome map
AA seq 388 aa AA seqDB search
MKIAVVGTGYVGLSNAILLSQHNEVVTLDLVPEKVDLINAKQSPIADGDIEHFLKHKTLN
LRATLNKEEAYKAADFVIIATPTDYDAKTYCFNTESVEEVIDDVSRCYPKAVMVIKSTVP
VGFTSKIKAQFACDNIIFCPEFLREGKALHDNLYPSRVIVGERSRRAEIFANLLKQGAVK
KDIETLFTDATEAEAIKLFANTYLAMRVAYFNELDTYAASHRLNTRQIIEGVSLDPRIGH
HYNNPSFGYGGYCLPKDTKQLLANYQDVPQHLIQAIVDSNRTRKDFIADAILQKKPKVVG
IYRLIMKSGSDNFRTSSVQGIMKRIHAKGIEIVVYEPVLKEKTFFGCQVIEDLVRFKNKS
DVIIANRPTYHLNDVSKKVFTRDLFGHD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcggtcgttggcacaggttatgttggactctctaatgctattttattgtct
caacataatgaagtggtaacgcttgatctcgtgccagaaaaggttgatttgattaatgca
aaacaatcacccatcgcggatggggatattgaacactttctgaaacataaaacgctcaat
ttaagggccactttgaataaagaagaggcttacaaagcggccgattttgtcataatagcc
accccgactgattatgatgcaaagacctactgctttaacactgagtcggtggaagaggtc
attgatgatgtgagtcgttgttatcctaaggcagtgatggtgattaaatccaccgttcct
gttggtttcacatctaaaataaaagcgcaatttgcctgcgataatattattttttgtcct
gaatttttgcgtgagggaaaggccctacatgataatctatacccttcacgggttatagtg
ggcgagcgttctcgacgagctgaaatttttgcaaatttactcaaacaaggggctgtcaag
aaagacattgagactctctttaccgatgccactgaagctgaagcgattaaactttttgcc
aatacctatttggcgatgagggtggcgtattttaatgagttggacacctatgcggccagc
cataggctaaatacgagacaaattattgaaggggtgagtttagatccccgtattgggcat
cattataataatccctcatttggttatggcggatattgcctccctaaagacactaaacag
ttgctagcgaattaccaggacgtgcctcagcatttaattcaggccatcgttgactcgaat
cgtactcgtaaagattttattgcggatgccattcttcaaaaaaagcctaaagtagtgggg
atttatcgtttgattatgaaaagtggctcagataatttccgcacttcttctgttcaaggg
attatgaagcgcattcatgcgaaaggtattgagatcgtcgtttatgagccagttttaaaa
gaaaagacgttttttgggtgccaagtaatagaggacctggtcaggtttaaaaataaatca
gatgtaattattgcaaatcgccctacatatcatttgaacgatgtatcaaaaaaagtgttt
actcgtgatctatttgggcacgattaa

DBGET integrated database retrieval system