KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0542Help
Entry
HDEF_0542         CDS       T00911                                 

Gene name
iscS
Definition
(GenBank) cysteine desulfurase (tRNA sulfurtransferase), PLP-dependent
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00730  Thiamine metabolism
hde01100  Metabolic pathways
hde04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HDEF_0542 (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HDEF_0542 (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hde03016]
    HDEF_0542 (iscS)
   03029 Mitochondrial biogenesis [BR:hde03029]
    HDEF_0542 (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hde02048]
    HDEF_0542 (iscS)
Enzymes [BR:hde01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     HDEF_0542 (iscS)
Transfer RNA biogenesis [BR:hde03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    HDEF_0542 (iscS)
 Prokaryotic Type
    HDEF_0542 (iscS)
Mitochondrial biogenesis [BR:hde03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    HDEF_0542 (iscS)
Prokaryotic defense system [BR:hde02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   HDEF_0542 (iscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Pyridoxal_deC Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACQ67295
UniProt: C4K402
Position
complement(541710..542870)
Genome map
AA seq 386 aa AA seqDB search
MKRPIYLDYCATTPVDKRVADKMMSFLTIEGTFGNPASRSHFFGWQAEEAVDIARNQIAS
LLGADAREIIFTSGATESNNLAIKGTAHFYKKKGKHIVTCQTEHKSVLDSCAQLEREGFS
VTYLSPKSNGLIDLEKFESALKKNTILVSVMHVNNETGVIQNIAHIGRICREKGIFFHVD
AAQSAGKLPINLSQLSVDFMSISAHKMYGPMGIGALFVRRKPAVHLEPLQHGGGHERGLR
SGTLPVHQIVGMGEACRIAEAEMSAQSDKMNILGDQLWYGLQHLDHIYLNGDLKNKVPHI
FNISFGGINGEALILSLKDLAVSSGSACISSTVTSSYVLRALEVSDELAQSTIRFSFGRF
TTQKEIEYAIELIPQYVLGLRKVLSQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcccgatttacctggattattgtgcgacgacaccggttgataaacgagtagcc
gataaaatgatgtcgtttttaaccatagagggcacctttggaaatcctgcttccagatct
catttttttggctggcaggcagaagaggctgtggatattgcgcgtaaccaaattgcttca
ttactgggtgcggatgcgcgcgaaattattttcacctctggtgcaacagaatctaataat
cttgccattaaagggacggcacatttttataaaaaaaaagggaaacatattgtgacctgc
caaacagaacacaaatctgttttggatagctgtgcacaacttgaaagggaaggcttttcg
gtgacttatttgtcacccaaaagtaatggtttaatcgatttagaaaaatttgaatccgcg
ctcaaaaaaaatacgattttagtgtctgttatgcacgtaaacaatgaaactggcgtgata
caaaatattgcgcatataggtcgaatttgtcgcgaaaaagggatcttttttcatgtggat
gcggctcaaagcgcagggaaattgcctatcaatttatctcagttatctgttgatttcatg
tctatttcggctcataaaatgtatggccctatgggaattggtgccctatttgtccgtcga
aaacccgctgtgcatcttgagcctcttcaacatggcggtgggcatgagagaggcctgaga
tcaggcactttacctgttcatcaaattgtcgggatgggagaagcgtgccgtattgctgag
gcagaaatgtccgcacaatcagataaaatgaacattttaggtgatcaattatggtatggc
cttcagcatcttgatcacatttatctgaatggcgatctcaaaaataaagttcctcacatt
tttaacatcagctttggaggaatcaatggagaggctttgatcctttctttaaaagatttg
gcggtttcttctggttccgcatgtatctcaagcactgtaacgtcttcttatgtactccgt
gcattggaggtcagtgatgaattggcccaaagtaccattcgtttttcttttggtcgattt
accacccaaaaagaaatagaatacgctattgaattaatacctcaatatgttcttggctta
cgaaaagtgttaagtcaatga

DBGET integrated database retrieval system